CAZyme Information: MGYG000003605.1_01314

Basic Information

• Species: Alistipes sp900770635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900770635
• CAZyme ID: MGYG000003605.1_01314
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42939.53	6.762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003605.1	2259375	MAG	Fiji	Oceania

• Gene Location: Start: 29195; End: 30322 Strand: +

Full Sequence      

MRYYVIAGEPSGDLHGGKLMRGIAKEDAEAEFRFCGGDMMAHTGGEHNMLYHYTQMSFFG
FVQVAKNLRTIFEQMDNVKADIERFQPDVIILIDYPAFNLRIAKWAKSRGIKVYYYIAPK
VWAWKERRVKSLRKYVDRLYTIFPFETEYFRGHGIEPIFCGNPLVDDITERRATFASRDK
FLSDNNLEDKPIVALLAGSRVSEINANLSDMVAIARRFPEYQFVVTAVKWIDIAIYEKIT
EGATNVKIVVDRTQESLAMADAAIVCSGTATLETALMRIPEVVLYHVPWLYEKLKPYFLR
IPYISLVNINLGREAVRELVKARPNIDEAEEELRSILPSGSKRERMLADFEELSTMIGGE
GASDRFAQDIVKTLR

Enzyme Prediction     

No EC number prediction in MGYG000003605.1_01314.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	1.6e-104	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.86e-99	1	375	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.11e-95	1	375	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.02e-69	4	353	2	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.14e-63	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.11e-47	1	343	2	338	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11605.1	5.27e-150	1	375	1	374
AFL77950.1	5.27e-150	1	374	1	373
BBL08813.1	5.27e-150	1	375	1	374
BBL00808.1	3.02e-149	1	375	1	374
BBL13420.1	1.03e-148	1	375	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.15e-33	5	357	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.18e-32	5	357	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.45e-60	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	6.71e-58	5	367	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	1.83e-53	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q6ALW0	3.79e-53	5	367	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	1.07e-51	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003605.1_01314.