CAZyme Information: MGYG000003610_00429

Basic Information

• Species: HGM04593 sp900770665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770665
• CAZyme ID: MGYG000003610_00429
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000003610_18|CGC2	40436.69	9.5637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003610	2461139	MAG	Fiji	Oceania

• Gene Location: Start: 39766; End: 40830 Strand: -

Full Sequence      

MVQKNNSKSKTILITRFSAVGDIAMTIPLLYSLSETYPEHRFIFVSRERFGQFFINKPKN
LDFIGINLTNYKGIGGLYRLYRELSLQRPDAFADLHDVLRTKILRTFFKVLGCTKVASID
KGRKEKRQLVHPDNTHKSELKSTFERYRDVFAKLGLPFTPEFTSLFGSGKGNLDDFTTII
PSKENDRWVGIAPFARHNGKIYPLEKMEEVVMLLSKQERIKLFFFGNGAEEENTINQWCS
KYANTVSFIGKSNFNGELRLISHLDAMICMDSANMHMASLVGTPAISIWGATSPLAGFLG
WRQEKADCIELPLECRPCSIFGNKPCRYGDYHCMNIPPQTIVDRTMQRISRQSN

Enzyme Prediction     

No EC number prediction in MGYG000003610_00429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	329	2e-35	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	8.92e-47	11	347	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.29e-40	9	350	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.86e-18	78	332	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	8.05e-09	250	351	238	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	6.04e-08	8	350	4	328	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12543.1	1.86e-116	10	354	4	352
BCI64055.1	4.27e-112	7	344	4	342
ATV26260.1	2.07e-111	8	344	2	343
APW31401.1	2.07e-111	8	344	2	343
BAR94939.1	5.88e-111	8	344	2	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34