CAZyme Information: MGYG000003614_01491

Basic Information

• Species: Prevotellamassilia sp004552865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp004552865
• CAZyme ID: MGYG000003614_01491
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33943.63	5.8893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003614	1915631	MAG	Fiji	Oceania

• Gene Location: Start: 33; End: 944 Strand: +

Full Sequence      

MAVYAMEHGKHVAVEVPAATTVEECFRLVRTAEATQRHCFMTENCCYDFFALQTLEMFQK
GKLGTITHCEGAYIHRIAEAEQEVKRGESEMFRRHWMAQSYSTHGGNPYPTHGIGPIAQL
LGIHRKDRFKTITSVTARGVRRGEEWIGKVNSSLLTTEGGVTILLQLDVTTPRPYSRLQT
VCGTKGFVQKYPLPVVEWMEEGGDETCGEVKPFSFSGEEALKVMEEQFSESAASQLWAEG
HKKGVPNEMNYVMDRRLIHCLHHGLPLDLDVYDAAEWSCLCELSQISAARGGVPVEIPDF
LGE

Enzyme Prediction     

No EC number prediction in MGYG000003614_01491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	300	9.1e-97	0.7493734335839599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.94e-12	1	188	83	257	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	9.16e-07	1	42	78	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM59059.1	6.16e-117	1	301	103	383
QFQ13595.1	8.09e-110	1	300	97	383
AVM54126.1	2.37e-106	20	301	36	297
BAD47705.1	5.44e-101	1	300	105	408
ANQ59599.1	5.85e-101	1	300	105	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.61e-53	6	300	134	433	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.52e-31	3	300	109	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q64XS1	1.09e-101	1	300	105	408	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0955 PE=3 SV=1
Q5LGW9	1.54e-101	1	300	105	408	Alpha-N-acetylgalactosaminidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0874 PE=3 SV=1
A6KY05	3.02e-101	1	300	102	405	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
Q89ZW9	8.29e-100	1	300	106	409	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4252 PE=3 SV=1
Q7MWF4	2.25e-76	1	300	144	451	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003614_01491.