CAZyme Information: MGYG000003650_00243

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_00243
• CAZy Family: CE6
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		46231.51	7.3205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 1249; End: 2538 Strand: +

Full Sequence      

MKHLLVTMMMVMMATSSFAQVDKNFYIYICIGQSNMEGNAPYEQQDMEGVDPRFQVMAAV
DYSGNQSNVHGRPSEVINKEKRTKGQWYTATPPLCRENTGLTPVDYFGRTMVQNLPKNVK
VGVINVAIGGCKIEAFLKDSIPNYMTTGPDWLRNTAKNYDSDPYKYVIDLAREAQKVGVI
KGILLHQGESNSGEESWSGKVKKVYNDMLTDLNLKAQDVPLFVGEVVSADRGGSCGPGMN
PIIDKIGETIPTAYPVSATGCTNAFDHLHFDAAGYRLIGMRYAQAALATMGIKYEVPAGL
AKVESPLVSNGFGGSSCIFNYVNPNAKSVVLSADFGEDKPMVKSGLDGVWTLSQGGLKAG
KHTYTFIVDGKAILDPRNANKSEDGKQSVVDVPEAPQFGGFGGFGGFGGPRPQGQGGPRP
QGAPQGPRQ

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	103	213	2.7e-32	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	1.51e-33	24	288	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
cd11294	E_set_Esterase_like_N	3.54e-15	318	393	4	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02858	E_set_Esterase_N	1.99e-07	319	376	5	60	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02859	E_set_AMPKbeta_like_N	2.66e-05	316	376	1	62	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
cd02853	E_set_MTHase_like_N	0.001	324	377	17	69	N-terminal Early set domain associated with the catalytic domain of Maltooligosyl trehalose trehalohydrolase (also called Glycosyltrehalose trehalohydrolase) and similar proteins. E or "early" set domains are associated with the catalytic domain of Maltooligosyl trehalose trehalohydrolase (MTHase) and similar proteins at the N-terminal end. This subfamily also includes bacterial alpha amylases and 1,4-alpha-glucan branching enzymes which are highly similar to MTHase. Maltooligosyl trehalose synthase (MTSase) and MTHase work together to produce trehalose. MTSase is responsible for converting the alpha-1,4-glucosidic linkage to an alpha,alpha-1,1-glucosidic linkage at the reducing end of the maltooligosaccharide through an intramolecular transglucosylation reaction, while MTHase hydrolyzes the penultimate alpha-1,4 linkage of the reducing end, resulting in the release of trehalose. The N-terminal domain of MTHase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85270.1	1.10e-113	2	376	9	374
QDO71517.1	3.11e-107	22	394	18	380
AVM57872.1	3.64e-107	17	376	21	368
QUT32423.1	4.74e-107	22	376	21	364
AVM52697.1	7.23e-107	17	376	21	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	1.57e-07	85	285	36	223	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	9.05e-90	14	376	35	394	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000398	0.998806	0.000229	0.000191	0.000176	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_00243.