CAZyme Information: MGYG000003680_01119

Basic Information

• Species: Prevotella sp000433175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000433175
• CAZyme ID: MGYG000003680_01119
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000003680_114|CGC1	65647.6	5.2798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003680	2339843	MAG	Italy	Europe

• Gene Location: Start: 96; End: 1886 Strand: -

Full Sequence      

MKKLFITVIAALCCHLTAPAGDIFVSPTAGNDKAAGTREAPLKTLEQALKQAREWRRLGS
KNAEGGINIIMDGGVYRLYKPLFIRPEDSGTADSPTIIRSADGQQAVISGGTVVTGWRRG
SDDERLPAQVRDKVWVADAPMAGNRMVETRQLWAGGRKAVRASQFADDVMERMKAFDTTD
ESITIPTPKTDLSRARQLEMVVHQRWAISILRVREIKNMGNGLSKVWFHQPESQIEFAHP
WPQPVIDGERGSSSFFLTNALELLDEPGEWYQDYPSGRIYYYPEDGNDPNTMDITVPVLE
TLVTIGGTRERHVSNIRFENVAFEHSAWRRPLYEGHVTLQGGFRFIDGYKLAEPGLFHKA
ELENQAWIARPEAAVTAQFADNIGFGSCTFSHTGATAVDLAYAVSSSDITGCTFTDIGGT
AIMAGWFGEQGFETHIPYTPAIDQDMCNRLTIARNTITDAANEDWGCGAVSAGYVRDTEI
SGNEVSHVNYSGICVGWGWTALESGMRNNRITGNTVTDYARQLYDAGGIYTLSNQPGSVI
SGNTISMPHPAPYATNNRAFCIYFDEATDGYTVSGNKMPEESFGYNRPGKDLKIIK

Enzyme Prediction     

No EC number prediction in MGYG000003680_01119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	22	580	8.3e-190	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	3.24e-09	388	577	16	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	6.47e-09	400	577	4	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.27e-07	441	576	2	108	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	3.88e-06	455	576	52	147	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	1.83e-04	393	544	55	171	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	1.81e-279	1	594	1	595
AII69040.1	2.53e-265	1	589	1	588
QUT84057.1	2.53e-265	1	589	1	588
QJR76527.1	2.74e-265	1	589	1	588
ALA74807.1	7.65e-265	1	589	32	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	9.70e-165	15	589	20	593	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.998934	0.000251	0.000158	0.000150	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003680_01119.