CAZyme Information: MGYG000003684_02137

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_02137
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	MGYG000003684_6|CGC5	90136.84	4.9882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 181838; End: 184237 Strand: -

Full Sequence      

MDSLTMRLEENWKFHLGEAEDAWYKGYDDSSWRDVVIPHDWSVEQPFSQEYSSGTGYLAG
GTGWYRVRFTLPEEYRGKKISLLFDGVYKNSQVWCNSYYLGKRPNGYVPFAYDISEKAFF
GDMDNEVSVKVTHTDVADSRWFTGTGITRKVCVLVEEAVHPVQNGIFFSTLYGDDGKSAQ
VEVSHEIVNEGTDKASVSLISSLWDAEGKKVLEVSSCTEFAPGEKKTIALNGCVKHPSLW
SPESPYLYRLNTVLSVNGEEGYEVFSGKVGIRTFRFDADKGFFLSGKNRKLKGVCVHHDG
GCLGAAMTKEVWERRLTALKEMGCDAIRTSHNPHMPELYDLCDEMGFLMMDEAFDEWENP
KNKWSTGHNVYPPKHQGYFEDFPEWHEKDLAAMVLRDRNHPSIIMWSIGNEIDYPNDPYC
HPLFGEMTGNNDKNKPAAERMYNPDKPNMERLSPIAAELAGIVRQYDSTRPVTLAAAFPE
LSSRLHYFDALDVVGYNYKEHLYEEDHRRFPTLPFLGSENGHSYQAWKAVRDNDYISGQF
LWTGIDYLGEAHGWPIHGSSAGLLTLAGFPKARYYRRKSFWSESPMVYLATVKYEGNHEE
WMPLYESWNYESGDKVLVRLFTNQPEAELFLNGKSLGARKELDGDGCMEWIVDYEPGELK
AVAGKLSAASSEGCVSFTLHTTGDAAKLLLSRWRSAREKGENADGLHPVYQVEITVADSE
GCRIGNADCLVEAQVTGSGVLLGLENGDLADNTPYSASSRRAYEGRLIAYIRRTGDGTIT
LRAHAENLPEEKLIIEENA

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	586	7.3e-117	0.6143617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.42e-73	8	552	15	507	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.01e-45	6	414	42	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.33e-35	62	411	121	462	beta-galactosidase.
PRK10150	PRK10150	6.13e-35	61	474	65	447	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	1.73e-27	12	154	8	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08200.1	0.0	1	779	3	788
CBL12712.1	0.0	1	779	8	793
VCV23256.1	0.0	1	797	3	807
BCJ99948.1	0.0	12	795	9	809
QHQ63248.1	1.28e-317	1	772	1	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T9A_A	6.34e-164	8	796	32	844	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.18e-137	6	791	10	801	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	2.67e-137	6	795	4	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	1.14e-128	1	795	21	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	4.41e-125	5	796	6	797	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.04e-155	11	795	50	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.59e-93	4	772	47	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	9.08e-46	8	798	56	815	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	9.96e-46	5	753	28	752	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	1.96e-42	5	791	5	731	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_02137.