CAZyme Information: MGYG000003690_00148

Basic Information

• Species: Lactobacillus gasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus gasseri
• CAZyme ID: MGYG000003690_00148
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000003690_1|CGC6	56937.95	5.7831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003690	1974540	Isolate	China	Asia

• Gene Location: Start: 164006; End: 165499 Strand: -

Full Sequence      

MTKTYSMPKNFYWGGASAANQYEGGYNEGGKGLNAIDVLTNGSATEPRKVTWKTNDGKTG
VTPMTWGKEFKLPDGAKPALLDNYYYPSHEGTDFYHHYQEDIKYMAEMGFNMFRLSLNWS
RILPNGDDQEPNKEGLAFYDKVFDECAKYGIEPLVTLSHYETPLSLINRFGGWKDRKMID
IFVHYADIVMNHYKGKVKYWLTFNEINAMDMAPYMGGGLIDGSKQNRAQGAHNQFVASSK
VVKLAHEIDKNNQVGQMLAYSAYYPYTSDPADQLLVMKAKQEMLFYSDVQTGGRYPEYRL
KEYERDGIKLDDRPEDYELIEKYPVDFLSFSCYTSNVLTTHEADAKANGNMSAGGVKNPY
LDYNAWGWATDPDVLRIALNDLWDRYHKPLFIVENGLGWGDELTKDHKVHDDYRINYLRA
QIKSMEEAVNEDGIPLMGYTMWSAIDLVSNGTGEMKKRYGFVYVDRDDKGNGSLKRYPKD
SFNWYKKVIASHGKDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	493	2.7e-141	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	5	497	2	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	4	497	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	497	1	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	7	496	4	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.60e-163	3	496	2	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABJ59601.1	0.0	1	497	1	497
QTH65613.1	0.0	1	497	1	497
ASY54359.1	0.0	1	497	1	497
QTP19800.1	0.0	1	497	1	497
ART98052.1	0.0	1	497	1	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	3.72e-168	7	496	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.06e-167	7	496	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	8.35e-167	3	496	4	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	2.98e-162	7	496	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.30e-155	1	496	2	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	4.39e-165	7	497	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.71e-163	7	496	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	6.40e-162	1	497	1	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.46e-159	6	496	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	7.12e-155	1	496	2	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003690_00148.