CAZyme Information: MGYG000003909_00049

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum
• CAZyme ID: MGYG000003909_00049
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000003909_1|CGC1	52548.17	5.1121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003909	2340068	MAG	China	Asia

• Gene Location: Start: 52948; End: 54336 Strand: +

Full Sequence      

MSNALQRDLERLVARIEREDGARAAADPYRQRFHLMPPVGWLNDPNGLCRCGDWYHVFYQ
YGPFDPTGGVKMWGHYRSRDLLHWEQLPPMLYPDQPWDIHGVYSGSALVEDGTMYLYYTG
NVKHAGDYDYITAGRGHNTALAVSRDGVTAASNELLLENKDYPADVTCHVRDPKVWAQDG
KYYMVLGARTKDDRGELLVYESADKRRWKHINTLTTPEKFGYMWECPDLFELEGQWFLVC
SPQGVTRQGNQYQNVYSCGCFPLYGDFRGDYTLGGFRELDCGFDYYAPQSFEDGGRRLQF
GWMGMPDADYTNPTVANGWQHCLTVPCELKRDGDRLLRVPAREITDLRGEHIPPERAQVF
DMECCAEPRGRLVIRRAAVVEWDKGQMSLTLVQGGAGRTVRYADVDAVRNLRVLADVSSL
EIFINGGEQVMTTRYYPDPAACGVQMEGVQADIWAMGALQIQ

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	34	337	3.3e-92	0.9863481228668942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.90e-153	40	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	4.31e-139	21	438	5	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.46e-131	27	450	26	472	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	4.42e-104	34	427	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	6.96e-104	34	337	1	305	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG05878.1	1.62e-204	3	456	2	463
CED94068.1	1.33e-163	3	448	2	463
QEH67471.1	3.47e-156	3	460	2	478
ADZ81804.1	1.20e-151	3	460	2	478
QHB24857.1	3.03e-151	3	456	2	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.41e-67	29	437	25	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.76e-66	6	438	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.61e-65	6	438	30	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	4.34e-56	32	436	42	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NU7_A	2.10e-55	22	436	25	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.42e-100	24	439	23	456	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	1.24e-88	24	437	21	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	1.51e-86	23	460	20	461	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
Q05936	3.35e-78	6	445	18	472	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P40714	4.62e-77	33	439	28	452	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003909_00049.