CAZyme Information: MGYG000003944_00442

Basic Information

• Species: CAG-884 sp000433875
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-884; CAG-884 sp000433875
• CAZyme ID: MGYG000003944_00442
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000003944_4|CGC1	40455.01	9.7006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003944	1325619	MAG	United Kingdom	Europe

• Gene Location: Start: 44911; End: 45999 Strand: +

Full Sequence      

MRVVVSAGGTGGHIYPALAIIDKIKEKEKTSEFLYIGTHNRMEKDIVPKRGIPYKEIEIY
GFNKKTLKNIKLLKCVIKSYKECKKTIKNFNPDIVIGVGGYVTAPVILAAHKLGYKTFIH
EQNSVPGKTNRFLGKYADKIGISFENSAKYFDEKKVVFTGNPCNEAALNSSKMDKKEVGL
SDNKDFVYIVMGSLGSDKMSNILVEMLSKFEGKNYEVVLVTGTNHYDKVKDMSFPKNVKV
LPYVDNQTRLMKQAKLVVSRCGATTLGEIITLGLPSIIIPSPYVADNHQYKNGLILEEKQ
AALMIEEKDLTIDNLYKNIDNLMNDSEKLSKMRENLKGLTQANGASNVYNVLASMIGDRN
DK

Enzyme Prediction     

No EC number prediction in MGYG000003944_00442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	187	341	4.8e-44	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.59e-134	1	357	2	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	6.43e-132	2	351	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	5.69e-105	1	352	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	9.66e-104	1	354	1	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	5.19e-47	3	142	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWI23359.1	1.49e-107	1	356	1	362
QWH38802.1	2.12e-107	1	356	1	362
AJH21406.1	2.12e-107	1	356	1	362
QWI12479.1	2.12e-107	1	356	1	362
QWH18949.1	2.12e-107	1	356	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	5.74e-42	2	313	8	313	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	4.49e-40	2	341	4	340	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.43e-38	2	355	11	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
7LVY_A	3.28e-06	190	337	298	441	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GRN6	8.49e-108	1	356	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) OX=315749 GN=murG PE=3 SV=1
Q812W5	3.42e-107	1	356	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG1 PE=3 SV=1
Q636B6	1.95e-106	1	356	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 1 OS=Bacillus cereus (strain ZK / E33L) OX=288681 GN=murG1 PE=3 SV=2
Q6HEQ4	1.95e-106	1	356	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=murG1 PE=3 SV=2
A0RHT1	1.95e-106	1	356	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus thuringiensis (strain Al Hakam) OX=412694 GN=murG2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003944_00442.