CAZyme Information: MGYG000003944_00650

Basic Information

• Species: CAG-884 sp000433875
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-884; CAG-884 sp000433875
• CAZyme ID: MGYG000003944_00650
• CAZy Family: CBM50
• CAZyme Description: putative peptidoglycan endopeptidase LytE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
109		11777.65	9.8295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003944	1325619	MAG	United Kingdom	Europe

• Gene Location: Start: 51855; End: 52184 Strand: -

Full Sequence      

MGQKLVIPEVKGEIGYVVKAGDSLYSIAKKYGISVDELKKTNGLTTNTLTVGQELVIPET
SKSRTYTVKSGDSLYSIADKFEVSVSNLKKVNNLTSNLLSIGQILVIPK

Enzyme Prediction     

No EC number prediction in MGYG000003944_00650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	16	58	1e-17	0.975
CBM50	66	108	3.2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	6.73e-17	16	107	482	591	1,4-beta-N-acetylmuramoylhydrolase.
pfam01476	LysM	1.96e-14	66	108	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK06347	PRK06347	3.35e-14	16	105	333	447	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	6.37e-14	16	105	408	521	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	1.21e-13	15	102	345	441	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC11836.1	1.37e-09	9	51	213	255
QOR66304.1	6.35e-08	9	51	90	132
QHS24286.1	2.23e-07	13	51	206	244
AGK53921.1	2.98e-07	4	51	144	191
QRM90483.1	4.06e-07	16	51	203	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	7.95e-06	12	44	1	33	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	2.32e-06	16	51	88	123	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003944_00650.