CAZyme Information: MGYG000003957_02628

Basic Information

• Species: Parabacteroides sp014287585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp014287585
• CAZyme ID: MGYG000003957_02628
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
159	MGYG000003957_61|CGC1	18273.47	6.6038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003957	4724401	MAG	United Kingdom	Europe

• Gene Location: Start: 1670; End: 2149 Strand: +

Full Sequence      

MDKKIFYLRRCRAAAEEAGHAFDMNPRVILAQGALESGWGTSCLATEHNNYFGMMGYGAA
NAWWHGERAELEAANGVVHYFRHYTSPRMSFFDFARLIHTGYHRAWSFSRIPEAYAKEIA
YSPYISEQNGDNRERYRQSIVALEEEIGRMMDWGEGMAA

Enzyme Prediction     

No EC number prediction in MGYG000003957_02628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	13	145	2.9e-22	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	3.15e-17	13	94	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	7.21e-16	13	119	52	160	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK12711	flgJ	1.75e-10	15	100	226	315	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK05684	flgJ	3.27e-10	15	119	163	275	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12713	flgJ	4.71e-10	9	98	190	282	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50226.1	2.21e-109	1	159	1	159
ALB75641.1	2.73e-68	1	152	1	151
QUT50521.1	2.73e-68	1	152	1	151
ALB76004.1	3.66e-68	1	152	1	151
QUT50705.1	2.29e-48	4	151	5	151

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QDN_A	4.36e-07	7	115	5	109	CrystalStructure of the endo-beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003957_02628.