CAZyme Information: MGYG000003993_01095

Basic Information

• Species: Alistipes sp900550925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900550925
• CAZyme ID: MGYG000003993_01095
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000003993_5|CGC1	44202.89	8.9311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003993	1895769	MAG	United Kingdom	Europe

• Gene Location: Start: 136550; End: 137704 Strand: +

Full Sequence      

MQSLKKITILGPAHPYRGGIASIMEILARTFKSRGCEADIKTFTVQYPSFLFPGKSQYTD
SPAPEDLRIERCVNTVSPFNWIRIGLRIRRERPDMLLMKYWTPFMGPCFGTISRIARRNK
HTKTIVQLDNVIPHEHHLIDRPCTSYFINSVDGFIYMSQQVKDDLDQFTRSKPALFSPHP
LFVNFGSRVGKREACEKLGLDPAIEYSLFFGIIRDYKGLDLLLDAWALLKKEGHTANRRL
IVAGEFYYNREKYIEQIARLGLQKDILLHDYFVADDMVRYFFSAADVLIQPYRSATQSGV
TQIAYNFSLPMIVTDVGGLSEIVPNDVVGYVTDTTAESIAAAFVRFYSDGNAERFRKNME
QEKQRFSWEAMADRLTEVYRMTLK

Enzyme Prediction     

No EC number prediction in MGYG000003993_01095.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	3.37e-32	6	380	1	370	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd03801	GT4_PimA-like	8.49e-22	6	380	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.91e-21	5	380	2	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	3.75e-11	148	375	136	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
pfam13692	Glyco_trans_1_4	4.48e-11	239	349	35	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL79017.1	4.01e-185	6	379	2	374
BBL14274.1	2.00e-184	6	379	2	370
BBL07853.1	1.89e-183	6	381	2	376
BBL10644.1	1.89e-183	6	381	2	376
BBL04766.1	3.29e-183	6	379	2	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L01_A	1.99e-06	191	379	239	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
2BIS_A	2.03e-06	191	379	240	428	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3FRO_A	2.03e-06	191	379	239	427	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU66	3.17e-10	205	383	194	372	Low-salt glycan biosynthesis hexosyltransferase Agl5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl5 PE=3 SV=1
B8HCF8	8.59e-08	199	349	220	371	D-inositol 3-phosphate glycosyltransferase OS=Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) OX=452863 GN=mshA PE=3 SV=1
Q0SF06	2.85e-07	188	381	220	419	D-inositol 3-phosphate glycosyltransferase OS=Rhodococcus jostii (strain RHA1) OX=101510 GN=mshA PE=3 SV=1
Q59002	1.39e-06	198	384	202	386	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003993_01095.