CAZyme Information: MGYG000003996_00732

Basic Information

• Species: UMGS2055 sp900557635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS2055; UMGS2055 sp900557635
• CAZyme ID: MGYG000003996_00732
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		23248.46	7.1052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003996	1767468	MAG	United Kingdom	Europe

• Gene Location: Start: 3157; End: 3786 Strand: +

Full Sequence      

MRQGKTDGGRRGIRIFLGLAAGAAAVAVLITAGLHLLGEYQERQKRRAYPYPEEYAALIE
KNAQDYGIPPEIICAVIRTESSFRADVVSPAGAVGLMQLMPSTFTWLQTKTGEQCKENAL
TDPAVNVKYGCFLLKMLYDEFGNWKTVWAAYNAGMNRVRTWLTDASYADENGLHTIPIQE
TENYVARVERAVAVYRELYFSPQNGGTPN

Enzyme Prediction     

No EC number prediction in MGYG000003996_00732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	68	191	1.1e-27	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.64e-57	52	191	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.42e-48	51	198	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.11e-33	70	188	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.86e-33	47	199	131	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.52e-30	59	162	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	9.02e-42	25	199	25	194
QCN93454.1	1.94e-39	25	201	13	191
AYF42704.1	1.94e-39	25	201	13	191
AYF39872.1	1.94e-39	25	201	13	191
AVQ97208.1	1.94e-39	25	201	13	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.61e-20	51	203	445	600	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.64e-20	51	203	474	629	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.05e-20	51	203	445	600	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.06e-20	51	203	446	601	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	5.45e-18	51	196	449	599	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.53e-17	59	188	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	1.03e-16	51	196	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.03e-16	51	196	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	2.95e-15	51	196	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	1.14e-12	51	188	1418	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998387	0.001257	0.000014	0.000011	0.000006	0.000368

TMHMM  Annotations     

start	end
15	37