CAZyme Information: MGYG000003996_00946

Basic Information

• Species: UMGS2055 sp900557635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS2055; UMGS2055 sp900557635
• CAZyme ID: MGYG000003996_00946
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		95101.9	4.5484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003996	1767468	MAG	United Kingdom	Europe

• Gene Location: Start: 110; End: 2722 Strand: -

Full Sequence      

MSDKKRQAEQKTDWGAEVGKAVGITGKVFRKILSVLLSILLTVLLISLITGTVVGSVFIY
YVQNYIDTDMEEFDNLGGSTTHTTTIYYVDSQTGNMVELEDQRLYGGKNSIWVPYSQIPK
NLVNAFVAIEDHRFWDHSGVDLLTTAKSAIKYFTGNPSGGGSTITQQLIKNVTGDDEVTM
QRKIQEIMRAFDLEKTKDKTEILEMYLNLIYLSHGCYGVQSAAYTYFGKDVSELTLTECA
AIACITQAPTKWDPVLNPERNKTRRGVVLDEMLKYGSITQEECDAAKKEDLVLKDASGSE
ESTSNVNSWYTDAAIEEAIQLLMNSKGYSYEVAQKMIYNGGLKIVTAMNPNVQSILEDYF
ENDANFPSVDSSPIQPEASMVIINPYNGNVVGLVGGRGEKSGNRILNYATQTTRSPGSSI
KPLSVYGPAMEYGEITYTSVFDDAPFNFGVATKGEGGSIVYSNTHGWPANLPDRYAGLTS
VYDALQRSVNTIAVRILDKLTMDRSFDYVKNKLHMDSFIESYTKADGEVLSDKNMSALAL
GGMNYGVTVLEMTAAYQIFPNGGIYNKARIVLEIQDSDGKTLVDNQSDSSIVMSEQTASI
MTKMMQNVVESPTGTAYKAVTLKSEVNCAGKTGTTTADCDRWFMGFTPYYVGGVWFGYSM
PSSLDGFSATVPPAAVIWNDVMTQVHKSILQETAAQGKTAECFELADGVVQATVCRDSGK
LMSEACKHDPRGNRAVTGYFNLSSMPTEYCDCHVLVNYDKVTGGIACEYCPEQNIVQVAL
VRVNRDFPINIKIIDAEYSYMDLGAASPGGTAYQPFYTPVLALGHYTGYSKGETTTQYNH
ACTEHTAPPPQTDGDSGDDGGGGESTTPTE

Enzyme Prediction     

No EC number prediction in MGYG000003996_00946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	107	272	2.2e-62	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	6.29e-179	112	687	4	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.30e-161	53	693	30	604	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.41e-129	53	759	19	777	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.23e-72	105	273	8	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	2.05e-69	106	701	54	569	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP94484.1	1.33e-164	83	807	79	799
QBB65500.1	2.98e-164	83	807	47	767
QUO33826.1	1.54e-160	56	809	50	793
QNL43378.1	5.83e-155	56	807	46	762
QIA31344.1	1.58e-154	83	773	75	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	2.52e-71	192	658	2	432	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	2.49e-69	108	773	38	835	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG7_B	2.50e-64	192	658	2	432	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	1.27e-51	92	659	13	558	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2JE5_A	1.38e-51	117	769	61	708	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	8.40e-105	111	798	77	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	8.98e-105	111	798	77	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	8.98e-105	111	798	77	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q0SRL7	1.09e-90	113	753	94	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	1.34e-90	113	753	94	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999939	0.000069	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
32	54