CAZyme Information: MGYG000004021_00726

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_00726
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		62090.97	7.3378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 39235; End: 40923 Strand: +

Full Sequence      

MKRITLLSGILFLAIACPIEAQYPTVPDSIQQRVAQENAYYDKLDNAAWEKALKIVKKEE
KKYGRVYRPWASKPKDLPQCQIPAFPGAEGGGAFTAGGRGGKVITVTSLADRGPGTLREA
CETGGARIVVFNVAGVIELKSPISIKAPYITIAGQTAPGDGVCVAGASFLIDTHDVIIRH
MRFRRGAVDVGNRDDALGGNAVGNIIIDHVSTSWGLDEVMSIYRHVWNRDETGKGTKLPT
VNITIQNSMFAEALDTYNHAFGATIGGHNCYFARNLFASNISRNCSIGMNGGFNLVNCVI
YNWWNRSVDGGDEYSQYNIINNYFKPGPVTALQNGKAIQYRILKPESSRDKNKPDTFGKA
YVNGNIMLGNDRVTADNWDGGVQVYGQRDCGKFEEAIRVDEPFAMPPHNPIMSAQEAYEF
VMENVGATLPRRDSVDTRIINTVRTGQAIYDKKARPFVTPYVKRRLPDDSYKYGIITHPQ
QVGGLPEYKGTPYIDSDNDGMPDAWEIRYGLNPNDPSDATGDCNDDGYTNIEKYINGIDP
TRKVDWTDLKNNRDTLTGRLQK

Enzyme Prediction     

No EC number prediction in MGYG000004021_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	1.1e-63	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	3.64e-04	95	327	48	280	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	3.95e-04	145	272	13	141	Amb_all domain.
pfam18884	TSP3_bac	7.81e-04	495	516	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68105.1	5.89e-299	14	559	15	556
QJR55559.1	5.89e-299	14	559	15	556
AII69027.1	5.89e-299	14	559	15	556
ALA74794.1	5.89e-299	14	559	15	556
AII63047.1	5.89e-299	14	559	15	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	6.71e-07	89	303	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	3.07e-50	82	541	20	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q0CLG7	5.88e-49	84	541	22	416	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
Q2UB83	1.13e-48	82	541	20	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	2.20e-47	82	541	21	417	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q5B297	2.25e-47	77	540	11	412	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000514	0.573334	0.425476	0.000261	0.000231	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_00726.