CAZyme Information: MGYG000004035_00774

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1815
• CAZyme ID: MGYG000004035_00774
• CAZy Family: GH63
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		58366.09	5.6903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004035	2175802	MAG	United Kingdom	Europe

• Gene Location: Start: 15167; End: 16693 Strand: +

Full Sequence      

MSFRQNCEITLVQNPHAAENVFLHKEPENRPLPTFAKERGRLPSPIWEGHEDAISCYWKA
WELAFGNLCQPHPGSGFVSNFIDTAFNGCIFMWDSSFILMFGKYGARSFNFQGTLDNFYA
LQHKDGFICREIIEENGEDRFTRFDPAATGPDIMPWCEWEYFKNFGDRDRLAKVFPPLLA
YHEWLRMYHTWPDGTYWSSGWGCGMDNLPRQQEGYPISYSNGHMVWIDACLQELMNCGIL
MEMARLLGREEEIAPLRQERENLARVINEKLWDEETGFYYDLWKNGKLNMVKHIGAYWAL
LAEAVPQDRVDRFVAHLENEREFKCPHRIPALSADHPWFAKDGGYWNGGVWAPTNYMVLS
GLDKYDKFALSHEIAKNHLRNVVDVYNQTGTVFENYAPFPGEDGKPRPGHPAKGDFVGWT
GLVPIAVLLEHVLGIKPDAEKNTISWHINLLERHGVEKYPFGKNATLTLLCEARNSKKEE
PQVTVTSTEPVTVQIFWDGGTQVIQAGK

Enzyme Prediction     

No EC number prediction in MGYG000004035_00774.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	7.32e-18	149	402	417	762	alpha-glucosidase; Provisional
COG3408	GDB1	4.63e-17	92	445	290	620	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	4.60e-15	171	423	188	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	6.70e-14	239	428	317	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam17389	Bac_rhamnosid6H	6.84e-11	144	281	93	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN83484.1	5.51e-221	10	507	10	510
AIQ57834.1	2.68e-216	14	508	10	499
QHT63246.1	5.49e-215	10	507	29	524
QHT63247.1	5.37e-198	12	504	29	519
BAX79981.1	2.18e-188	10	508	42	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	1.82e-12	91	447	390	795	Murineendoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
3W7S_A	9.82e-09	210	407	535	741	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	9.82e-09	210	407	535	741	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.05e-08	210	407	84	290	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.05e-08	210	407	84	290	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	6.66e-39	95	471	62	429	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	7.33e-16	91	423	409	800	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
Q80UM7	7.15e-11	91	431	445	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
Q84M89	2.12e-10	35	433	338	788	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1
F4HTM3	2.90e-10	35	422	401	840	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004035_00774.