CAZyme Information: MGYG000004036_01586

Basic Information

• Species: UMGS1820 sp900545865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1820; UMGS1820 sp900545865
• CAZyme ID: MGYG000004036_01586
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		23647.95	7.7472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004036	2961055	MAG	United Kingdom	Europe

• Gene Location: Start: 8510; End: 9139 Strand: -

Full Sequence      

MRSVQNMPRRAPSKRHGGCGAGFLVFILFLAVVIGVIWFIAKGSGSITDRIRKTQYPIKY
EHFIEKYAKEYNLEPSLVFGVIRTESDFDVYAVSSADAKGLMQITDETASDCAKKIKMKN
YTSDMLFDPETNIKLGCYYLNYLIGKYKHVSNALAAYNGGPGNADDWIESDENTDSSGKL
VNIPFSETQNYVRRVLEAQQMYKELYNIN

Enzyme Prediction     

No EC number prediction in MGYG000004036_01586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	202	8.2e-29	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.04e-68	57	201	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.73e-58	56	205	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.11e-40	75	200	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	2.27e-38	63	200	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	4.39e-36	51	207	130	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18574.1	2.06e-52	1	206	1	213
AIS52076.1	1.57e-45	48	209	23	185
AAM24132.1	9.86e-44	26	206	5	182
QWT54455.1	1.03e-43	1	208	1	208
AWZ48130.1	4.58e-43	25	209	8	186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	2.56e-19	41	203	435	599	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	2.13e-18	41	206	395	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.13e-18	41	206	399	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.14e-18	41	206	409	573	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	2.14e-18	41	206	405	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.42e-18	41	203	462	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.42e-18	41	203	462	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	4.82e-18	41	203	462	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	4.67e-17	49	195	51	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
Q1CB94	1.43e-16	59	203	190	356	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.986607	0.004191	0.000753	0.000023	0.000013	0.008445

TMHMM  Annotations     

start	end
19	41