CAZyme Information: MGYG000004050_00065

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004050_00065
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		45223.14	4.4886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004050	2129816	MAG	United Kingdom	Europe

• Gene Location: Start: 81267; End: 82454 Strand: -

Full Sequence      

MKKLVLAIAAVAALVSCAEKKPVPMSVRMVESQMSRCPDATWLDYAEGKLKWSYTPGLEL
KAFLDVYETYGGQDIYDYVEAWYDAAVNDDGTIKTYSVDKYNVDLICPGRSLFYFYDKTG
NEKYRKAAELLKTQIDGQPRTSEGAFWHKQIYPHQVWLDGVYMATPFYAEYASRYLEGEE
QLEAYREIVNEFVVAAEHTYDPVTKLYRHAWDESRSMFWCDPQTGQSQHCWGRALGWYCM
AIVDVLDWLPEDFEGRTVLVGKLREICAELPKWADPESGVWYQVLDQPGREGNYLEATCS
TMFSYVFLKGVRLGYLDADLLPYAKQVYQDVVDEFISTDEQGRISLEKCCAVGGLGGSDN
RMGDYAYYLSEPVRPNDSKGVGPFIWASLEMERLK

Enzyme Prediction     

No EC number prediction in MGYG000004050_00065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	393	7.1e-116	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.20e-97	26	395	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.54e-91	46	394	26	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	9.25e-149	24	393	29	398
QDO69177.1	6.51e-148	24	395	31	397
QUT93209.1	5.29e-147	24	395	31	397
ALJ61262.1	5.29e-147	24	395	31	397
QUT77882.1	1.94e-145	24	395	31	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.31e-105	52	394	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.46e-69	51	394	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.03e-68	51	394	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	3.49e-11	38	332	34	321	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.35e-68	51	394	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.00e-36	163	390	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.00e-36	163	390	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.26e-21	52	345	29	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000126	0.999922	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004050_00065.