CAZyme Information: MGYG000004050_00076

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004050_00076
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943		103834.27	4.7084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004050	2129816	MAG	United Kingdom	Europe

• Gene Location: Start: 96383; End: 99214 Strand: +

Full Sequence      

MKQTLTALALLLSGTLAGAAGTMPDQPFGWAVSATFTTGDNYNLDGGADGKTIILQSNGF
DMREDIIKAVKDYDTIVFDGSRGDFTVSQAIRFQGLYGKTFLGINGARICTGFSVTPEIT
AILDAKGVKAMSDQGDGGVLSNGARVAEERELNTRQALIDLTGDSSERYRDAGLFSFSGC
ENIIIRNLALVGPGPIDVGGADLLTISNGSTHFWVDHCSFTDGMDGNFDINTRSDFITVS
WCTFSYTERAYDHKASNLIGNSNDPTRQGADNLNITFAYCIWGKGCEVRMPVVTFGKVHV
LNCLYDCAGNYAPAVNAKHEAEILIEDCFFEKGVKNIFEADQDALGWQFKDNIFREKFKP
EDKGTVELPYSYSAIPASRVPRTLKAENGAGPTLNIPAPESSVSFTIHLIGDSTMADKDI
SGGNPERGWGMVFENFVDDSVRVINYAKNGRSTKSFIDEGLWDKVKANMRPGDYLFIEFG
HNDQKEGKESVYAPAWGAYQDNLRMFIRTARELGATPVLLTSVARRHFTDGILDEETLGD
YPEAMKAVAKETGTMLIDMEAATIAWLKEAGDEASRQYFMWVEPGTCAAIPEGRQDNTHS
NARGARRNCEIVCDSIRAKIPGIAAHLVRYDFVVDQDGRGDFMTLQEAIDAVPDYRGRTT
TILVKPGIYRERIIIPASKSRLRISGCGADKTVITWDNAARKRWPDSEDEMGTFGSASVF
IDASDVTLEDLSIRNDAGSGDIVGQAVALSTTGDRLFFNRCHFFGNQDTIYTGGKYNDDG
KSCRSYYLDCLIEGTTDFIFGPGACVFENCEILSKKNSYITAASTLEGEDYGYVFIRCKL
TAAPGINKVYLGRPWRDYAKVVWIDCEMGSHIRPEGWHNWSRPEREKTAYYAEYGCTGPG
ADTSARVGWSHQLTEEQAAEYSFEKIMSAERYGSLWDPFGTLQ

Enzyme Prediction     

No EC number prediction in MGYG000004050_00076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	632	927	2.6e-102	0.9861111111111112
CE12	406	616	1.8e-73	0.9952380952380953
PL1	172	332	3.7e-38	0.7326732673267327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	7.95e-80	406	616	2	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
PLN02432	PLN02432	4.45e-79	634	921	15	280	putative pectinesterase
PLN02773	PLN02773	2.50e-78	634	921	9	290	pectinesterase
PLN02682	PLN02682	1.87e-76	630	918	69	352	pectinesterase family protein
pfam01095	Pectinesterase	9.17e-76	631	922	1	290	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37158.1	7.34e-161	394	938	14	561
AVM52203.1	2.13e-157	404	938	24	575
QQA07818.1	6.82e-157	405	938	25	563
BCA48647.1	6.82e-157	405	938	25	563
QUT41965.1	8.57e-157	405	938	32	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	8.14e-44	633	919	6	289	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.17e-41	633	909	10	281	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	2.29e-32	629	926	30	357	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	6.48e-32	640	906	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.19e-31	640	906	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.13e-63	634	931	9	300	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O23038	2.60e-55	612	919	72	374	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q9FM79	8.91e-55	628	936	78	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	2.47e-54	636	921	90	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	2.51e-53	634	921	53	320	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.998848	0.000211	0.000204	0.000186	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004050_00076.