CAZyme Information: MGYG000004050_00923

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004050_00923
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000004050_23|CGC1	80729.99	4.4388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004050	2129816	MAG	United Kingdom	Europe

• Gene Location: Start: 11130; End: 13271 Strand: +

Full Sequence      

MKFRILAASLLSAGALLLAGTSDYSFAQGNGDLLKETDPAFFMTPDARRIANQILVWQRV
TGGWPKNVDMVSPMDEEDISAVLSEKGRLDDSTVDNGATCSQMLFLARAYSATGDSRYRD
AFVRGAEYILGGQYENGGWPQFWPEQSGYQFHITYNDNAMVNVLELLAGIRDADSPFDGD
LADYDLRSRAAEAFDKGIDCILRTQLHHDGNPAIWCQQYDCRTLEPAAARAYELPSFSPQ
ESVGIVRLLMSLPEPSEEVKAAVRGAMKWFDTYKLTGYRVERYVDKYGRRETRLVEDGTA
GPLWARYYDLENVEPYVCDRDGIPRPRLEDIGYERRNGYRWYDSSPAGLYEEYAEWADEF
DPEQKVEVSLQTPGANETGLIAMFRRPAVDRSRFDVVVSPGESIQEAVEKAPEDGGEPFC
ILLLDGIYEQKVVIDRPDVVLVGESRDRTVIRFAEGEKNRGSYTYRGRDAGNGVISIWDE
GDDFILCNLTVYNDYGTTVEPTTSHQFAVFGRGTRTIILNCNIWSDGNDALALWAPEGNG
MYYHADLFLRCPGVDFLCPRGWCYATRCRFLGDTPEGADGNVRHAMIWHDGRGDRSRKLV
ITNSEFDAAHPTLLGRYHHDSQFFFVDCAMSSNILDEDVCYAYVDKVLDPCPWGHRVWYL
DCFREGGDSGWLSNNIDEEGENLKYYTVLPDWTFGGRWDPEAHIRRLWNVLAY

Enzyme Prediction     

No EC number prediction in MGYG000004050_00923.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	58	347	8.1e-110	0.9895833333333334
CE8	402	636	4.2e-28	0.7708333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	5.48e-139	58	349	1	288	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	6.73e-110	58	346	1	286	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG4677	PemB	8.73e-11	392	639	79	357	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.86e-10	395	616	1	218	Pectinesterase.
PLN02432	PLN02432	5.84e-07	404	577	26	178	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61703.1	0.0	3	713	7	707
QUT92735.1	0.0	3	712	7	706
ADY37490.1	0.0	1	713	8	708
QJR78975.1	0.0	40	713	49	713
QJR66036.1	0.0	40	713	49	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.02e-56	27	356	61	404	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	4.92e-55	51	341	37	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	6.66e-54	51	341	37	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]
2NSP_A	1.90e-08	394	693	4	338	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
2NTB_A	2.46e-07	394	693	4	338	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A8	3.61e-07	380	693	14	362	Pectinesterase A OS=Dickeya chrysanthemi OX=556 GN=pemA PE=1 SV=1
P0C1A9	8.43e-07	380	693	14	362	Pectinesterase A OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000438	0.998531	0.000379	0.000243	0.000204	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004050_00923.