CAZyme Information: MGYG000004053_01551

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_01551
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		88955.82	7.6363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 4642; End: 7023 Strand: +

Full Sequence      

MKCRQLFFAVVSAFCCAAFGVSDVPRYFDNARWVAPAPYGSSYEIVNSYNLYRRAFSLDS
VPKSAPMCVSADQNYRLYINGVFVCSGPARGFYWEQPFDELDVARYLKKGRNVIAIRQYC
VGRGTFAYIPSGHSGAVFALDLGGGKCVLSDDNTKGRRQIGCRRDTAQLSVPMNNQEHID
LRVENPDWFKPDFDDSAWARCYTRVRTALPYSAFERRTIPMLDEREVFPVALVSAGAGKS
GGDSENVFDVSALFDSDKIEFRAVENGAKVAVSEPSDGVRAFVFDFGAMSAGMPILKIEG
ANGGEIVDIRATELLDSNNADTVRCGSRLAPANRLICRAGTQVHEFYQLLGFRYLAVRVR
NNASATLKITPSMRWSTYPLGERGSFESSDALAEKIWRASVRTQRVCSLDSFVDTPYREQ
AQWWGDARVQGWNAFFISGDARLLRRGIKSISMQKTPDGLTHGYAPDGTRACVLPDYSLI
WILTVWDYYWQTADPEPYIAHRDTVRSIFDYFDKMSSPETGLAQYDKRYWLFLDWCKMHK
AGQSAVLNLWLLHAYDKMRDLCIQNGFTDDARDYAVRGARLRSAIIKNLLRPDGLVSDGI
FPDGTQNPNTGIHAQTLAKICEIGGFDFKKALETVILPYVETEGLVKAPTNFSERMSKVV
KPSSYWSVYILQVLVDAGCEKQAYDYILRMWAEFADYGSVGEMFNVPDTSTHSHAWSAHP
AFLLPRILGGVRQEAAGWKKVSFKPNRFGDFAKVVYPTPQGEIKVSWRKNDDGTYTDKID
LPAGVELSDGGFR

Enzyme Prediction     

No EC number prediction in MGYG000004053_01551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	281	786	3.7e-86	0.9742063492063492
CBM67	47	200	2.8e-28	0.8522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.18e-17	384	728	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.29e-08	730	786	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.60e-04	274	370	2	97	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF89243.1	9.13e-198	20	785	8	790
SDT92885.1	4.41e-197	28	785	7	756
QYY35421.1	6.64e-197	25	788	11	764
SDU02729.1	4.12e-190	23	786	8	767
QYM78626.1	1.79e-176	28	785	15	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.74e-48	30	788	7	938	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	3.72e-14	372	765	290	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002925	0.882444	0.113742	0.000368	0.000252	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004053_01551.