CAZyme Information: MGYG000004075_01668

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004075_01668
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		61939.72	4.8809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004075	2841804	MAG	United Kingdom	Europe

• Gene Location: Start: 670; End: 2340 Strand: +

Full Sequence      

MRILDNLKFIGTDERVRKFLLPTRIVSAAGTVQHAENLLVQKPLQIGLAEKEYTILENGD
DGSHASVVLDFGTELHGGIRLMAYMNDGSAYPEVRITFGESVSEAESMLGEKNATNDHAV
RQFVIPVPSLSDQEWGQTGFRFVKLELLSANTRMALKAVLAVFIYRDYPYKGGFQCSDAD
LNQIFDTAAYTCHLNLQNMVWDGIKRDRLVWIGDMMPESMTVRNLFGAIPLVEESLDFVR
EQTPLPGWMNHFPSYSMWWILILWDWYMASGNQDFLQKNRDYALGLLNNLCALVQDDGTD
SLDAYFLDWPTADTKAAVSGVRALLRMTLDCGKRLAEIYGDPTLAVRCADRREKLDLIAE
QPFGSKAAAAFLALAGVMKKEDAAALITQNGVSGLSTFMLYFILRAVAENGEETKALEML
KTYSLPMLAHGATTFWEDFQYEWSSNSCGIDRLYSEGEADIHGDFGAYCYTGLRHSLCHG
WASGAVPFIMETVLGISILECGCKAIRIRPHLCGLKWAQGSFPTPYGVVHVRHEQQADGS
VKTEITAPEEIHVITG

Enzyme Prediction     

No EC number prediction in MGYG000004075_01668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	65	551	3.2e-90	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.20e-10	172	437	4	310	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.00e-07	495	549	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEM11316.1	1.88e-175	12	554	36	585
QTF59433.1	3.04e-174	12	554	36	585
QTE60670.1	3.04e-174	12	554	36	585
QEM02776.1	3.04e-174	12	554	36	585
QTE59866.1	3.04e-174	12	554	36	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.52e-37	41	531	169	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.56e-10	56	491	89	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004075_01668.