CAZyme Information: MGYG000004148_01374

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004148_01374
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		93163.13	4.6382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004148	1959033	MAG	United Kingdom	Europe

• Gene Location: Start: 1685; End: 4171 Strand: -

Full Sequence      

MSIKRLALCRSQGRLFVLLRFVGQDIAGLIEREGFQDFAHATTNDASVPSLTLPVDHGRV
LALCPSVADYECELLVLVFPFMDGSTVDVSFASGDKRLGSIRLDNRIAKLESKINYKAKP
AMCALVRDAQRGECCGRYEIDAVRYLPADEGVVWRYEVKWAGDPQCAPELQIFDTHMNAI
DATVHVFESQVDVPQQNGCRVNKTYLSVEMPEDIRDFVAIAADPTGQIQSGFCAMDGRLY
NGMVDDSWNRMKDARADDAAYRRWFDQHRAKPGDLACQHVALAAFAYRPLVSIVVPCYKT
DRVYLRELLDSVLSQSYDNWELLLMDASPEWDAVANLAADVNDERVHRIELPGNGGIVLN
TNAGIQQAAGDYIAFFDHDDILEPDALFHYVAALNKAAEGERPQVLFCDEDMFQKTGEWG
QPVFKTQLNVDLLYSHNCVTHFLMVEKALIDRIGMSPEDVAGAQDYDLTLRCLASGARFE
HIAHVLYHWRVHPASTADGSADSKPYAIEAGRLALQRHFDSLDVQGTVEETETPFVYRMR
YTLPEPAPLVSIVIPTKDHVETLDACVMSIAQKATYANYEIVLVENNSEAPETFAYYETL
PERVAAVSEGKGGARVVYWPGEFNYSKIIDFGVEHAKGDYLLLLNNDTEVINPDFIEEMM
SYLQRPDAGVVGAKLYFADHLVQHAGILVGVRGALAHANQDFSAKREGYLARAVRPGNFS
AVTGACQMVRRDVFERVGGYNEEFAVGFNDADFCLRVWEAGYRTIFTPYAELYHYEFTSR
GREEADEEKLRRWKREQALFMQRWPEFFLDGDPWLGPILSSDSEYFSF

Enzyme Prediction     

No EC number prediction in MGYG000004148_01374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	292	452	4.3e-22	0.9823529411764705
GT2	551	737	1.7e-21	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.89e-84	289	491	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.71e-39	552	776	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.05e-32	548	801	3	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	7.16e-21	292	496	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.98e-20	551	734	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53737.1	0.0	1	828	1	828
QIA33434.1	0.0	1	827	1	827
AZH69434.1	0.0	1	827	1	827
QOY61397.1	5.64e-285	1	826	1	799
ACV56016.1	1.39e-178	76	825	46	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	4.03e-09	290	394	6	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.33e-108	258	804	338	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.96e-73	271	780	301	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q68X33	7.93e-17	287	498	6	218	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q9ZDI9	2.60e-16	287	498	6	218	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
Q4UM29	4.52e-14	287	664	12	397	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004148_01374.