CAZyme Information: MGYG000004172_01805

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01805
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		33123.8	9.6455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 39895; End: 40803 Strand: +

Full Sequence      

MIELSIVIATYNRAQPLLRTLGSLARQTLDPALWEVVVVDNNCADDTAARFARWAEAHPK
VNARLTREPQQGLSPARNRGVAESAGAYIAIIDDDEEVNPEFAESYFRFFRDYPGAAAAG
GRIVPLYEYAPPAWLSPYTERPIAGTLDLGPEARPFPARKFPGGGNMAVRRSALVRYGAF
DPALGRTGANPLAGEEKELFGRLRAGGEQVWYVPGAVIYHIIPESKFDPAYFDRLTRQSG
VSERIRTQGISRAAYLARLLAEAVKWGGTLALAAGYALRGEAIKGRYLIRMRRNVTCGLL
KG

Enzyme Prediction     

No EC number prediction in MGYG000004172_01805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	174	2.7e-25	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.06e-27	5	174	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	9.26e-26	6	213	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	2.19e-22	1	232	2	231	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.71e-22	6	220	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	5.52e-21	1	274	2	282	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG54097.1	1.23e-119	2	300	15	313
QGA23906.1	9.77e-111	3	302	3	302
BBL03370.1	1.90e-110	3	300	3	298
BBL15447.1	1.54e-109	3	300	3	298
BBL07044.1	4.02e-94	1	302	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	2.53e-07	4	226	95	335	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.53e-07	4	226	94	334	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYH3	1.33e-09	3	245	2	241	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1
D4GYG7	1.36e-08	5	104	9	107	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
P71057	3.02e-07	5	108	7	106	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P33697	9.80e-07	3	123	11	120	Succinoglycan biosynthesis protein ExoO OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoO PE=3 SV=2
Q15JF5	1.19e-06	4	105	42	142	Validoxylamine A glucosyltransferase OS=Streptomyces hygroscopicus subsp. limoneus OX=264445 GN=vldK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01805.