CAZyme Information: MGYG000004185_02108

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_02108
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		36526.16	10.2109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 12984; End: 13913 Strand: +

Full Sequence      

MTMKCIYRLLAFAAFILLMLPIQAQRRNSLYNNYIKEYAPLAVEQMNKYRIPASITLAQG
LLESGAGRSQLARKSNNHFGIKCHNTWRGRKVYHDDDAKGECFRAYRKVEESYEDHSKFL
KNGPRYAFLFKLKITDYKGWARGLKKAGYATDPSYANRLITIIEDYELYKYDSKGMSRRE
ARRWEKELKKKPWLANPHQIYTSNKLLYVVARTGDDFRLLGKEFDISWKKLVKYNDLHRE
YTLQAGDIIYLMEKNKKAQEPHRVYVVKDGDSMHSISQKFGIRLKNLYKMNRKDADEYVP
EVGDRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000004185_02108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	168	2.1e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.14e-43	34	172	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	4.21e-41	33	172	45	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	3.56e-32	33	172	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	5.21e-30	33	163	153	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
pfam01832	Glucosaminidase	4.61e-27	39	168	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI81840.1	4.92e-182	3	309	1	307
QPH57455.1	5.74e-181	3	309	1	307
QBJ17132.1	2.33e-180	3	309	1	307
QUT99590.1	3.31e-180	3	309	1	307
QUT34698.1	9.48e-180	3	309	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.45e-18	40	163	10	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.02e-18	40	163	11	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.13e-17	40	163	11	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.28e-14	34	172	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	4.68e-13	51	172	80	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.91e-17	48	172	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	6.88e-17	33	167	165	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	3.14e-16	32	181	162	323	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P37710	2.88e-15	32	296	181	462	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	1.31e-12	51	176	340	476	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000215	0.999175	0.000170	0.000147	0.000144	0.000136

TMHMM  Annotations     

start	end
5	24