CAZyme Information: MGYG000004210_00333

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004
• CAZyme ID: MGYG000004210_00333
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1073		118640.01	5.0341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004210	2253787	MAG	United Kingdom	Europe

• Gene Location: Start: 335839; End: 339060 Strand: +

Full Sequence      

MKGKRLMKKIIAANLAAAMALTLSPVIGAEQNVKAESAPYDLESFGLDEVAVTDDYYLSA
QEADIDFLCQFDADRLLSRFRETAGIDTQGKKPYQGWEDSYIGGHCVGHYLTAAAQAVDA
TGDPTLSGILEYMIDELKVCQDTLGTGFIFGAKIQDKNNVEKQFDIVEGKDSGDTWVPWY
NMHKVLTGLIDVYRYTDNDKALEVAKGLGTWVYNRVSKWDSGTQQRILWTEYGGMNDCLY
ELYRITDDTTYRDAAHKFDDPDLYKTITSGNADTLSGRHANATIPKFLGALNRYRVLSEK
NELTSEDEQYLYYVEDFWDLVISKHSYATGGVSDMEHFRNDNALDETRTQCNCESCCAHN
ILRISRELFCLTGDVKYADYYETTLRNAIMGSIDTNDGTTSYFTPMATGYFKFFGEADPA
KNMFWCCTGTGMENFTKLGDSIYFHNNDSLIVNQYVASVLNWKDRGLTLTQTSDVTKSDE
ASFNISVSSPQTLSIYLRIPEWISGPAYIAINGESVVNADMDNGYVKLERTWQNGDTITM
KYPMTVQAVGLPDNNTVYAFRYGPTLLAAKLGTEKMDLSVGDNLTWAGANLSAAAYKYVG
DESCRLSIGYNTTNKQILGTETLQITDSTLDEFLTNIADNLVRNTNSDTLEFSLTGTDAD
DNFDGGLTFVPFNTLNDERYGIYWYFSAMTQEELEASILKDKEDGRIANCRIDSLQPGYG
QYEQDAIHEIRESGSVSGTIEQGGSTRHASPGGYFSYDLIVNPAKTNSVLCRFAKEDNGK
TIKISVGDTVIATDTLSYDGDDSFYTKAYEIPADVFANAVKEKVVTNDAGAQEKYTVVTV
KFESADGNDSARLVGGLYTIVNFNNNAAITNITVTQGTSVVTQDNDNTFTIKVPLGTQFI
KASVTLADKTGLLYVNDRLVNDGKVQTFTINGESKAFTLRAYAEDHTTYKDYTLNIVPTN
DLSQQGDNNTPSNPSDTGSVTPPSQQIINAQPVEKKAKAKIKIKGKKTVKVGKSIKLKAK
LTNVKGKVKWSVNKKKLAKITKKGKLTAKKAGKVKVTAKVKKVKASVTIKIKK

Enzyme Prediction     

No EC number prediction in MGYG000004210_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	50	568	1.2e-174	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.82e-138	49	568	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.81e-92	50	572	12	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.34e-05	636	684	38	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04792	LanM-like	5.12e-04	121	257	562	678	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam12733	Cadherin-like	0.005	887	956	15	86	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17203.1	2.11e-200	35	858	29	814
ADL33431.1	6.75e-199	42	858	2	776
ANY68649.1	1.92e-195	33	956	341	1209
AIQ16786.1	1.20e-190	42	957	16	859
AIQ54502.1	1.16e-188	42	962	16	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.49e-101	19	812	8	772	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.11e-97	19	812	8	772	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.32e-24	179	549	142	522	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.54e-15	307	549	285	537	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.998835	0.000172	0.000234	0.000186	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004210_00333.