CAZyme Information: MGYG000004229_01053

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000004229_01053
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		78988.61	5.1305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004229	1979607	MAG	United Kingdom	Europe

• Gene Location: Start: 70770; End: 72872 Strand: -

Full Sequence      

MQHTTWIWNEAAPATNCYVDFAAELTLEELPAAAELAICADSEYAVWINGAFVNCGQYHC
FPAARIYDSLPVAEYFTPGKNRLCITVYYQGEQSYQYVKGDPGLWFVLTSGSRVLAQSDS
TVLSAPSLTYAPGAHMVTLQYGYGFVYNAAKEDAWRNPQVPLPERFSASRRYEGAVPAPR
PIQKCVIQPLQTGVLLSQGIFTRTREDANPAVAIYHDAISYRVPWEVFEDPSVLAPKTEE
NFFVVMDLGREIAGYVTLALEAEQGTVVDIAWGEHIDCNGVATYIAGRSFANRYIAKQGK
QTFTHYFRRIGGRYLQLHIVGKVTSINTVGIYESLYPVKLPPLPATGDRLTDRILQISRE
TLRQCMHEHYEDCPWREQGLYAGDSRNQMLCGYYAFHETAFPRACLDLMGQSMRPNGFLG
ITALTDDALQIPSFTFIWMISMAEYIAYTGDISLAERYFPAMLRTVRSCTRDLPQGIAVH
PFGKGIWHFYEWSEGCNGGTIYQPDPWLDYEAGHRDGLYQMFLYAALSSTACIAEALGLT
EIRRELKDTMAVLKQGIRKVFWNDEKQRFASFVDGGQQNHYCQLMQAMAVFNSIADEHTN
TLCRALTEDKDLVKITLSYNIYLYEALLMQGDTYREYVLEDIIEKWGKMLYAGATTFWET
EDGASAFGGAGSLCHGWSAVPLYIYGRFFQGISPEDFRKQ

Enzyme Prediction     

No EC number prediction in MGYG000004229_01053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	243	695	1.5e-70	0.8690476190476191
CBM67	5	149	2.6e-16	0.8125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.71e-19	346	683	8	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.002	244	318	8	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK57365.1	3.29e-152	2	694	5	718
AUS95627.1	1.97e-150	6	685	13	704
QGQ97405.1	2.63e-148	1	694	6	719
ARN56684.1	5.50e-128	6	694	25	717
AQQ71631.1	4.38e-104	2	694	8	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.01e-47	230	693	425	880	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.72e-25	225	694	174	641	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	4.10e-15	342	688	207	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000025	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004229_01053.