CAZyme Information: MGYG000004234_01561

Basic Information

• Species: Massiliomicrobiota sp002160815
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160815
• CAZyme ID: MGYG000004234_01561
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000004234_84|CGC1	55509.33	4.8602

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004234	2339347	MAG	United Kingdom	Europe

• Gene Location: Start: 4953; End: 6398 Strand: +

Full Sequence      

MGFRKDFLWGGAIAAHQAEGAWNEGGKGVSIADVMTAGSNGVARRITNGVIDGEDYPNHV
GIDFYHHYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDEQPNEEGLKFYDDLFDEMHRLG
IEPIVTLSHFEMPYHLAEKYNGFMDRRCIDFFVKYAKVCFERYKGKVKYWMTFNEINNQA
ELISMGAHHLAQEGAVLVKEGDDIEYMMYKSAHHELVASALAVKAAHEIDPDAKVGCMIG
MNGVYPATCNPEDVLNAQQAMHQKYWYVEVHARGHYPKHLLKKFERKGYDNFILPEDEKA
LAEGCVDYIGFSYYMSYATKYTGRFGRSFDFSEEDYVRNTYLKASDWGWQIDPVGLRWCL
NWFNDRFELPMMIVENGFGAYDKYIDDNDEYVVDDQYRIDYLAAHIAAMKEAVDYDGVDL
LGYTMWAPIDIVSASTGEYDKRYGFIYVNYNNAHEGDFSRAKKKSFYWYKHVIETNGEDL
D

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	477	5.3e-148	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	480	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	481	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	5	480	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	481	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	481	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN11763.1	0.0	1	480	1	480
BCL57339.1	5.73e-292	1	480	1	475
QQY26504.1	1.08e-285	1	480	1	475
QMW75032.1	1.08e-285	1	480	1	475
QPS11697.1	1.08e-285	1	480	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	3.50e-211	5	480	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.00e-210	5	480	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	2.25e-202	5	480	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.17e-199	5	480	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	5.62e-191	3	481	11	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	6.42e-199	5	480	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	7.09e-191	5	480	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	4.50e-167	3	480	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.25e-157	1	481	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	9.72e-155	3	481	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004234_01561.