CAZyme Information: MGYG000004239_00252

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004239_00252
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34671.04	6.2392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004239	1498755	MAG	United Kingdom	Europe

• Gene Location: Start: 27; End: 947 Strand: +

Full Sequence      

MRRHYETFVSEDDFRRMAQIGLNAVRLPVPWYAFGSQESDASYISVVDYIDRAIEWAAKY
NIRVLLDLATVPGGQGDSNDSPATPEAVAEWHSSTNGRHVALDVLERLADRYGEAESLLG
IELLDTPQMSVRKSLFTMTDGIPAHYLRNFYRDAYELVRSYMPEDKIVVFSSSGHPSEWK
HFMRGAKYKNVYMDLHLYHYRDEHALDITSPRGLTTAISRNKRELKEAISTGFPVLVGEW
SGAAIFANSSVTPEGRNAYERVFIANQLASFAPAAGWFFQTWKTEKRIAAWDARAALGTL
ERGMIE

Enzyme Prediction     

No EC number prediction in MGYG000004239_00252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	3	264	1.1e-60	0.8741721854304636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.20e-24	3	286	68	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	5.24e-05	6	242	22	238	Cellulase (glycosyl hydrolase family 5).
pfam02449	Glyco_hydro_42	0.003	11	120	13	131	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54675.1	2.99e-223	1	306	48	353
AZH68982.1	2.99e-223	1	306	48	353
QIA34389.1	6.03e-223	1	306	48	353
AEB06471.1	4.59e-158	1	305	49	353
QWT17456.1	1.40e-148	1	306	73	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.86e-30	1	240	47	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	7.59e-30	1	240	47	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3O6A_A	5.10e-22	1	285	66	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	6.67e-22	1	285	61	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	6.67e-22	1	285	61	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	1.38e-29	4	292	80	382	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	1.38e-29	4	292	80	382	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q12700	6.54e-29	1	297	94	405	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
Q0CR35	2.13e-28	4	297	89	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
A2RAR6	2.13e-28	4	297	91	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004239_00252.