CAZyme Information: MGYG000004272_00819

Basic Information

• Species: UMGS915 sp900546795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; UMGS915; UMGS915 sp900546795
• CAZyme ID: MGYG000004272_00819
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		61092.65	9.6337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004272	1866208	MAG	China	Asia

• Gene Location: Start: 28039; End: 29643 Strand: -

Full Sequence      

MNKKIWLIVGVAAVILLFWGNGSLLVTDSVESNYALTAKEMVRSGDWMSPQIYGRYWYDK
PIFFYWLTALAFRIWGYTEFAARFFPALFGLGGLALLAWGSRKLYDEKTAVYSTVVLLSA
IEFFLISKSVITDSTLFFFFSGVLLYFYLGYRDNKPVYWYAMYASAALAVLTKGPVGCLL
PGLIICIFLTKQRGWAVLKRMKLGSGILFFLALSVPWYLYMYQVHGDIFLQTFFGTHNVL
RATVSEHPRDNVWYYYLAVNSLALFPWTGVIPAAVWNWWKKGRKKIEEREVFLLIWAGTV
FVFFQCMATKYITYTYPLLFPAAILLGRYVREQAAILQKKRYGIGMFAVYVLLAGAAYWL
GHSGRLDVQAGYMIWAAIGMALCLWQWSRKDKNSVLEVGMGAVLIYLTLISSVAVPLSQE
RSGYSVAQDLNRTAGLTEQVGVLGSYPTSAVFYSDNRQLLKLVHEKELLAEKPQGFSWND
KNVMPMAAIEQNDCTILLVKKAEWERFKTLPESRDWQIDMTDRNWYVLKKTNGI

Enzyme Prediction     

No EC number prediction in MGYG000004272_00819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	473	7.8e-107	0.8925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.46e-49	1	389	6	402	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.96e-23	3	362	3	373	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.77e-15	59	218	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	9.35e-05	31	225	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	6.99e-194	1	533	1	529
AEQ23377.1	3.66e-140	1	516	1	525
ADB46704.1	6.05e-139	1	516	1	526
AOH47263.1	1.05e-118	1	517	1	464
AXL22207.1	1.18e-117	12	516	39	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.64e-35	31	435	59	461	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	3.42e-30	1	352	1	343	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8GDR9	3.38e-25	21	354	25	363	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
Q2NWA9	6.17e-25	31	374	34	380	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1
Q4K884	2.23e-24	31	357	65	389	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
C5BDQ8	2.58e-24	31	357	32	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.810953	0.185010	0.002494	0.000377	0.000344	0.000845

TMHMM  Annotations     

start	end
5	27
62	76
81	100
110	127
134	152
167	189
202	224
257	279
291	308
312	330
342	361
371	388
395	417