CAZyme Information: MGYG000004287_00873

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_00873
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		36535.06	6.6132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 35574; End: 36542 Strand: +

Full Sequence      

MLKRRVITSTLIILTGLSGTAHADSIQQAHYDACEDVKNLKPIDEGQLASHDEEYINAYL
AEYESAIDNLNREPNSSENKEEAQSISEPDLHTYLPQLPSAIQAKFINRIAPVTQQIGKE
YDLYPSVIIAQAALESDWGCSMLGKSPYNNLFGVKGYFDQQTVSQLTTEYDPQGQKLQVF
SNFRRYPNEYEALKDYAKTLDDPLYHDVHRQNTSSYRDATRALRGRYATDPQYDQKLNRL
IDTYQLTKYDDQVRSGNENMKPLPLAKKEMASNSTPAVIDKHPVQASKTDLDIPQYIPLL
GGIGTVGLIKVIRQRWKKKKKA

Enzyme Prediction     

No EC number prediction in MGYG000004287_00873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	111	246	1.1e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.55e-51	103	251	43	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.03e-42	73	256	117	309	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	1.74e-41	106	268	323	484	amidase domain-containing protein.
smart00047	LYZ2	3.61e-29	104	250	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	1.43e-21	64	253	107	304	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWD62747.1	6.54e-142	1	322	1	339
AGR64497.1	1.37e-140	1	320	7	343
QLQ62599.1	1.65e-138	1	320	1	340
AXX74928.1	1.90e-138	1	320	7	342
QDR72191.1	8.24e-138	1	320	7	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	7.49e-40	103	250	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	9.33e-31	85	252	42	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	2.27e-10	106	242	4	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.67e-10	106	242	5	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	3.04e-10	106	241	6	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	2.00e-30	93	257	170	340	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	1.58e-29	106	259	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	2.74e-29	104	257	63	220	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	3.25e-29	85	252	302	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P0C2T5	1.50e-28	106	259	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000353	0.998873	0.000237	0.000205	0.000164	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004287_00873.