CAZyme Information: MGYG000004309_00624

Basic Information

• Species: Fusobacterium_B sp900542625
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900542625
• CAZyme ID: MGYG000004309_00624
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		43150.45	9.818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004309	2339352	MAG	Israel	Asia

• Gene Location: Start: 60268; End: 61377 Strand: -

Full Sequence      

MIRKLNRLFQSYAREKRLKIGKFIWDRKIKAEIKEGNNFLKDNNIKSILFLRYDGKIGDM
VINTIMFREIKKYYPDIKIGVVTRGGATDIITNNKNVDKIYNYEKKSKKIKELAKEIAAE
KYDLLIDFSEMLRVNDMMFINLCSARINMGLDRQKWQLFDISVNSEIDFKWTDHITKRYS
AYLIKLGIEKNKLDISYNVFVKEKEIFKEFFNNIKQNKIVVINPYAASRHKSFSIETLEK
IIKFFNNKDTAVILLYFGDKKTELKNLENEYTYLPPSIKSIEDSISIISKADLVISPDTS
IVHVSSALKKKLICVYPPNGGRFGVDHLVWAPLGDNIKILFCKETSKYGEIDINTFDFEE
MILEIKNML

Enzyme Prediction     

No EC number prediction in MGYG000004309_00624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	112	320	9.7e-25	0.8177777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.95e-48	45	367	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.37e-30	47	345	1	255	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	2.27e-09	48	338	10	304	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	4.23e-07	113	340	4	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR56601.1	4.32e-178	1	369	4	375
ATV05921.1	4.84e-177	1	369	4	375
QQS88563.1	2.94e-174	1	369	4	375
ASS39697.1	5.91e-174	1	369	4	375
QQB72907.1	1.19e-173	1	369	4	375

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	5.29e-14	37	355	31	343	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2
Q9R9D5	3.32e-10	58	337	5	291	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
Q57336	1.14e-07	46	316	9	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	4.75e-07	58	337	5	291	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004309_00624.