CAZyme Information: MGYG000004341_00773

Basic Information

• Species: CAG-110 sp000435995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp000435995
• CAZyme ID: MGYG000004341_00773
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	MGYG000004341_8|CGC1	55004.85	4.3792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004341	2568452	MAG	Israel	Asia

• Gene Location: Start: 37206; End: 38708 Strand: -

Full Sequence      

MKRILSVFLLIAMTVSTFAILPAQAAAPITSTEEDSIVPSPWDSIETEGGAFSSEIEEAG
LTYAAQGAETYGARSSSLPFRDVSSSSWFYDEVVYVYEAGLMDGISSTEFAPNASLTRAE
VVTVLYRLDGSPAVDGGSAFTDVPDGAFYSKPVAWASQNGIVEGVGNHEFLPKKSITREQ
IATIFYRYYAGYLGNSAPSSSLSGYTDQGSVSGFAREPMAWAVYSGLIRGINASHEAPRL
EPQSTSTRAQVATLIHRLDLLLEDESGCRSSQRIIDFIKEREGFSATPYWDHSQYTIGYG
TYCGSSRDEVPASYWDGITRDEAEVLLRESIASNYEASVIRYESGLGRRFTQGQFDALVS
FTFNLGSGWMYDDCRLTRWLENPSTDLQLVWAMGVWCRAGAVNTHLCKRRIQESNIFLYG
DYTGTGSHPNYCYTVYDGNGVLMGSRYDDVGYYVLGEAYGTLPTPNSDSYSFLGWYTRDG
AQVTSASTVRADQTLTARWD

Enzyme Prediction     

No EC number prediction in MGYG000004341_00773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	271	413	5.3e-23	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	2.24e-27	275	418	2	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.95e-14	271	422	8	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	1.16e-09	269	413	1	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00395	SLH	2.52e-09	80	121	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	2.04e-08	89	186	651	749	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK83697.1	4.13e-36	79	258	352	526
QCI60723.1	2.24e-35	79	263	392	571
ARE59829.1	5.80e-34	78	255	783	957
QQR06511.1	5.80e-34	78	255	783	957
QNL43287.1	1.35e-30	54	257	361	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	5.56e-09	80	259	26	196	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	5.65e-09	80	259	5	175	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]
6ET6_A	8.54e-07	236	418	20	194	ChainA, Lysozyme [Acinetobacter baumannii]
7M5I_A	2.25e-06	271	418	10	154	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	5.61e-18	70	258	1273	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	8.29e-18	68	258	29	213	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
P38535	4.11e-14	72	258	900	1080	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38536	4.75e-14	61	258	1663	1854	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38537	1.03e-10	75	257	28	204	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000214	0.999147	0.000168	0.000171	0.000155	0.000137

TMHMM  Annotations     

start	end
5	27