CAZyme Information: MGYG000004392_00045

Basic Information

• Species: Eubacterium_R sp900539325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539325
• CAZyme ID: MGYG000004392_00045
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		73993.89	4.9466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004392	1828862	MAG	Israel	Asia

• Gene Location: Start: 48897; End: 50822 Strand: -

Full Sequence      

MFKLTSNRLKREFKITDEKFYASQIKNTYSGMNFVPDGNGTEFVVHFADGKELSSKGLPV
EYSDYEDDKLVFRFEESDGLQITLKYWVHKDGNTVCKQIFIDQTDDRVIDFIELENIGII
NSKTHFGVDIVEGGEIPAFHSMLGQPIYIDSLFFGCEFPATENRILHGSATIRYFIGKPL
GKGFECPVTVMGGGKDNTLPSVRKAFYEYIESISVPAPLRFQYNSWYDYMKDITEQNIMT
SFTEVHKQLTHYGAPELAAYVVDDGWPDVKAGFWSFNKKFPNKLTNVTALCKEMGSKFGL
WLGPRGGYTRPDKIAKRYQRAGNGYLNKEAMDICVASTKYIEKLGDFLVETTNEFDIDYW
KLDGFCLKPCLNEKHDHMVGGYEDMYFATDMWQKWIALYDKLRAAKPDIWINMTCYVNVS
PWWLQWVNSLWVQNSGDIGFAKNLENQAQVDKEITYRDARYFDCLCTRALQIPLKNLYNH
EPIYGNTAHVDYTDEEFEKYIYWCTVRGQALNELHLSVNMMNESKWTSLAAAMNWQKDNY
HILQNAQFIGGNPEENNIYGYISWDGDDGVIALRNPTDEETSLTLTLNKLMGAPEDLQGA
KRFNVYCKLLEETDETYAYNSKMDLTMKPFEIMIFKIGKEK

Enzyme Prediction     

No EC number prediction in MGYG000004392_00045.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.62e-13	223	411	6	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	4.35e-07	184	304	253	377	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	4.45e-06	223	438	5	181	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17677	Glyco_hydro38C2	5.00e-04	565	636	11	73	Glycosyl hydrolases family 38 C-terminal beta sandwich domain. This domain is found at the C-terminal end of various glycosyl hydrolases belonging to family 38. The domain has a beta sandwich fold.
pfam02065	Melibiase	0.002	184	304	2	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26415.1	8.22e-146	9	638	43	725
QDO70357.1	9.96e-146	9	638	43	725
ATD48595.1	9.78e-128	105	639	348	917
SQG39183.1	4.94e-127	105	639	348	917
SQI04569.1	6.84e-127	54	639	304	917

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004392_00045.