CAZyme Information: MGYG000004436_01031

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696
• CAZyme ID: MGYG000004436_01031
• CAZy Family: GH31
• CAZyme Description: Sulfoquinovosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40239.84	4.8106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004436	1421600	MAG	Israel	Asia

• Gene Location: Start: 872; End: 1936 Strand: -

Full Sequence      

MIDDGWMRYYGSREFNQNTIPDPCALVRELHDMGFTVMLWICPFISPDSAEFRDLEAKKY
LVRDRDGNTAIRHWWNGYSAVVDLSNPDAYRWFYDNMRYLQTEYGFDGFKMDAGDVFYYR
DDDVTYAGVTAHEQCALWTKLGAQFPYNEFRASYKGAGLPLVERLGDKPHRWSALPKLVT
DLLTQGILGLPYGCPDMIGGGSFVDFLPGAPSLMPELFVRYAQCAALMPMMQYSAGPWRV
LDETHARYCLDAGEVHMRFADTILSLAAHAAKTGEPIVRYLEYVFPHEGLARVTDQFVLG
EDILVCPVLVENAVTRTVRLPRGTWEYVDGSIYEGGTTVTVDAPIDVLPYFRKK

Enzyme Prediction     

No EC number prediction in MGYG000004436_01031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	2	353	3.9e-74	0.8360655737704918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	4.81e-144	1	325	38	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	8.17e-61	4	353	304	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.78e-57	2	351	64	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	2.14e-34	21	354	269	619	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	3.21e-32	21	238	65	296	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS65358.1	4.96e-133	1	353	154	507
AEI41761.1	6.80e-133	1	354	153	507
AFC30265.1	5.49e-132	1	354	153	507
AIQ34466.1	2.14e-131	1	354	153	506
ASY50994.1	3.04e-130	1	353	156	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7S_A	3.15e-33	21	353	368	728	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	3.61e-32	21	353	368	728	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5F7U_A	1.69e-27	22	353	438	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
6JR6_A	3.08e-26	3	354	303	684	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
5X3I_A	2.35e-25	21	351	373	729	ChainA, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3I_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZQ1	3.61e-56	2	347	351	706	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
Q6NSJ0	6.78e-56	2	351	352	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
D2PPM7	1.15e-25	21	351	353	709	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
P19965	1.47e-22	28	354	344	682	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
P96793	1.79e-20	14	338	317	651	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004436_01031.