CAZyme Information: MGYG000004461_01006

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_01006
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1115		127818.4	8.716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 154231; End: 157578 Strand: +

Full Sequence      

MNRKWSAIWILLCLTLCLNAETGSITEKGFVRDWLISGPYPSYQVNGEGTALDTDFLDSE
AEAKPYPGLRRKSSFLADKAKLIAGIGSTNEWGFTETKSFDADWKEYSFPEDIITLDKMF
LPIDDYFAVYAVCYLEVPDAVDAVFVVGSDDDHKLFLNGKMVGRQYSSQGVVPNNFCYPV
RLEAGINRILLKVVDRIRGCGFCFSVADRSGKPIPGLKVHSDHPGRKLGYALYNNGCAAT
FQFAGSTLFEGKNKLKIEVYPSQKYEILFNGKKLLEREFDLNLKEGTHPLKLEFFEKGKR
VSLLTDQVTVYSKVKLEQENRTLERQIASMKRTLPELEQLVKRLKEEVKSAEKSLNQTYD
SLEKSYAQERAWNAGNAPKSIAEKLPPATLRSRLCINGEWEASTDRKNWHKVLLPLRMMN
RFFLRGAFPVHPKNPKNVYGAYEVDKGYEDFSLSPVITAKRSFFRIPFQYDGTGSVVFVS
EGIMGKAKFFCNGTLCGEYDGRIGILNIELKNLRKGKNVFELEFEVGRINTRYGILGDLY
FDFVPSVRVADVYVKPSWRKAALDVSAELVNHTGVPVKAEIRQYAAREGIIHLKLPPVRT
VIPSGKTAEVETRSGWADPLIWGIGGKYGNPDMYDLVTDVYLDGKLADRHIQPFGFREFW
IHRTDFFLNGKRIILQGEVGNAGCNEFRFRDIVWSLYRYDNINILRYHDSDYWSATAART
TDRMGMLSYVQMYPELHEPGTKKPYEKNFSPLETWMETATHQWNLDNYRRWFRMFRNNPS
VVIWSTDNEILTQAWDTVEKAPFNLRNDKIGAMYEKFMKTLDHDLVLTRNGDVGTQNSKG
RWFENPPCDTANYHYPDFNIDRQVRNWQKVYEYRPVIFGETLYCSYGAWDSWIGAIPEQV
LKKAQRVREVAGLYRHLGVPAQIYMGVGLDGFIIWDDSGKGNPWGITRSMMDEYDHRKIL
PPGRKADEYPKFRIPWPAYSGRGERKICISIAAKNYANTAYNWFDERYPSHIRNAVNDAY
RETLIPQPPLRVGNDAECIVETAPGTDVWSVSATGERYGVRSDRNGKAWFQFDFPGIYTF
TDGAASKTLRLGDRKGYVNKPGFGNIPHYRLRNEN

Enzyme Prediction     

No EC number prediction in MGYG000004461_01006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	391	861	1.5e-28	0.5132978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.77e-14	488	790	113	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	6.13e-09	547	657	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	2.73e-04	666	888	8	212	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
TIGR04523	Mplasa_alph_rch	2.86e-04	273	365	471	562	helix-rich Mycoplasma protein. Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.
cd04751	Commd3	0.002	265	354	4	93	COMM_Domain containing protein 3. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44993.1	5.53e-293	3	1113	55	1225
ATP55748.1	6.24e-19	374	885	31	505
QUH31336.1	1.95e-17	530	889	151	467
AIQ32428.1	8.99e-16	390	889	1	518
QSF44046.1	1.76e-14	390	889	1	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	2.73e-11	481	885	108	499	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4CU6_A	5.68e-08	461	790	75	429	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	5.68e-08	461	790	75	429	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
7CWD_A	1.27e-07	461	849	69	451	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
3DEC_A	1.56e-06	442	789	100	460	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	4.31e-09	534	789	220	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q48846	9.44e-06	533	789	215	465	Beta-galactosidase large subunit OS=Latilactobacillus sakei OX=1599 GN=lacL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999138	0.000184	0.000144	0.000145	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_01006.