CAZyme Information: MGYG000004461_02508

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_02508
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		29985.08	7.8475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 49519; End: 50283 Strand: -

Full Sequence      

MIPKRIHYCWLSGSPLPENIQRYIDEWKQLLPDYEFRLWDAAAFDVNSVLWVKEAVEERK
YAFAADYIRFYALYHFGGIYLDSDVRVMKKFDEFLKYPSFIGFEYCGVPEAAVIGCEPGC
LWIKDCLDWYDKRSFRKPDGSLKCAPVPLLIKDVLEKRTGTVIMDTGKIVPLPDVMLYPC
AYFSPKSLYTDKIELTPETVCVHNFSSGWLKKGILFKIAMFVHLVMLLLIGKENHNRFWY
HLWKWPYRKDEKDK

Enzyme Prediction     

No EC number prediction in MGYG000004461_02508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	95	3.7e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	6.36e-18	1	98	81	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.96e-11	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam12919	TcdA_TcdB	1.18e-06	4	71	1	81	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam05704	Caps_synth	7.63e-05	1	95	45	144	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	9.28e-05	18	84	124	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE16183.1	1.78e-84	1	237	1	236
QRO25778.1	2.93e-79	1	237	1	224
AVM55800.1	2.11e-78	1	237	1	233
QRM72494.1	8.16e-78	1	237	1	222
QRP88735.1	8.16e-78	1	237	1	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33300	5.77e-09	1	101	54	157	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
Q10323	3.23e-08	2	101	57	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UT67	2.51e-07	1	101	81	184	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
P38287	3.60e-07	1	101	61	164	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
213	230