CAZyme Information: MGYG000004465_01864

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004465_01864
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		37948.79	4.3952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004465	2247261	MAG	Israel	Asia

• Gene Location: Start: 4556; End: 5575 Strand: -

Full Sequence      

MASGGVLNGKGDVWYPSEDYIRAEQLSEKGLNVPIGEFDDEFWESVRDFLRPVMVSIREC
ENVLLEGPTFQNSPAWNIHPLMCKNVIVNDIVVRNPAYSQNGDGIDIESCENVILTNSSF
DVGDDGICIKSGKDEDGRRRAMPTRNLIIDNCFVYHGHGGFVVGSEMSGGVENIVVSNCR
FLGTDVGLRFKSKRGRGGVVRNIYIRDIYMTDIVTEPLLFDLFYGNMSAVDAMKQEGEYK
EPEAMPVDETTPEFRDIYIERVVCNGAARAMYFNGLPEMPVSNIHVTDCVITSETGAQIC
FSKDVTLTDVTIHPEEGEPITTYKVENYTFRKTKENPEK

Enzyme Prediction     

No EC number prediction in MGYG000004465_01864.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	4	297	1.5e-71	0.7107692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	8.21e-59	50	316	236	501	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	9.79e-25	1	226	57	252	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	7.85e-20	51	224	137	301	Probable polygalacturonase At3g15720
PLN03010	PLN03010	5.93e-17	42	235	156	331	polygalacturonase
PLN02218	PLN02218	3.07e-16	3	228	164	359	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53315.1	4.65e-138	1	327	181	505
QIK58732.1	4.65e-138	1	327	181	505
SCD19741.1	2.31e-137	14	330	200	515
QRX64943.1	5.08e-137	2	329	185	510
SCD22213.1	1.42e-134	1	328	182	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.83e-46	1	299	127	415	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	6.55e-37	9	293	157	427	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	5.39e-21	18	229	303	506	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.05e-34	60	297	30	267	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.57e-29	49	317	196	459	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	4.88e-21	51	226	323	496	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
Q9LW07	6.37e-20	51	225	137	302	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q9SFB7	1.51e-16	1	224	163	356	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004465_01864.