CAZyme Information: MGYG000004499_02293

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_02293
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000004499_33|CGC1	40245.31	9.2761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 31532; End: 32677 Strand: +

Full Sequence      

MKLHRLVVTCGGTGGHFYPGLSTARVFQEEFGGEVLLLLSGVNSARQKEIACAAGIRAVE
LPLMPSPGHSPARALRFLRGLAGGYRAARQELAAFQPQALLGMGSFASLPAFLAAKKQHI
PCFLHDGNARIGKANRWLSRGAELLATAFPPVNAAACRCRVITTGMPVRPELAKYAGISR
AEAIAGLNREFGSRFDPALPVILIFGGSQGARIFNVTCPAALKAQNRADFQVLHLAGPAR
LEEALGAYEGAAFPRLVLPGSEKMELFLGAADLVLSRSGGSTVAELALFGRGAVLIPYPY
AAENHQSDNADFLASAGAALRIDNAQFTPERAQELFTGFLADPAAWAERGRRAAALARPH
AARELIEEISAGTASRDCIPG

Enzyme Prediction     

No EC number prediction in MGYG000004499_02293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	202	361	1.9e-41	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.64e-91	5	343	3	325	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.24e-88	5	343	1	325	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.10e-76	5	343	2	325	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.30e-73	5	343	2	322	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	1.38e-31	201	334	1	135	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45852.1	3.41e-149	6	370	6	369
QSH42448.1	1.06e-117	2	370	7	371
QSR84496.1	1.52e-55	1	369	1	360
AVX31455.1	1.78e-54	5	367	2	362
AVX21035.1	1.78e-54	5	367	2	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.41e-36	2	369	8	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.34e-31	6	367	5	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.21e-28	5	370	8	351	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C3MEM9	2.27e-48	6	373	6	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=murG PE=3 SV=1
A1AU61	7.17e-48	5	369	2	374	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) OX=338966 GN=murG PE=3 SV=1
A0L5N1	3.13e-47	5	366	7	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=murG PE=3 SV=1
Q8UDM8	1.45e-46	6	372	6	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=murG PE=3 SV=1
Q92NL9	1.85e-46	6	373	6	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000095	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_02293.