CAZyme Information: MGYG000004510_00126

Basic Information

• Species: Prevotella sp002481295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002481295
• CAZyme ID: MGYG000004510_00126
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000004510_2|CGC1	49160.52	9.7836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004510	3097673	MAG	Israel	Asia

• Gene Location: Start: 10305; End: 11585 Strand: -

Full Sequence      

MITIKNKYLWMVLIALLPLLPLHAQHRITRKAKAKAATEQKAKALNQIFKVNDYWQKNHA
PETTAFWNVAAYHTGNMEVCKWLTQELSSNKKLSAKRRKLLTDKLNAYLAYSLRWAEHNQ
WKGATEADTAKWLYKKYGEDQQHVLFGDWQICFQTYIDLYNMYQAQQGSKGQTLTKMEIS
SPDLMTARAKEVMGYVVSHSAHDYWWWADALYMVMPVMMKMYKLTGDVRYLDKLYDNICY
SDSIMLDKETGLYFRDGKYIYPMHKTNSGKKDFWARGDGWVLAGLAKVLQDMPKSYRHYD
FFLKKYQRLALAVAKIQQPEGYWTRSMMDPQQAPGPETSGTAFFTYGMEWGVNHGLLNAK
TFKPVIRRAQNYLTTVALQSDGSVGYVQPIGERAIPGQHVDKDSQADFGVGAFLLAATES
LRSQNR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	421	7.7e-66	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.23e-71	48	424	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.15e-33	204	422	130	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84432.1	1.54e-181	36	422	2	361
QVJ79822.1	1.43e-175	29	426	13	371
ADE82673.1	6.70e-174	29	422	13	367
AGB28481.1	2.64e-173	33	426	18	380
QDW22441.1	3.65e-155	36	422	32	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	7.24e-148	42	422	31	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.09e-134	35	422	7	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	6.24e-48	205	422	152	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	5.38e-13	202	419	136	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.17e-12	202	419	126	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	4.02e-47	205	422	159	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.28e-44	205	422	157	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	7.01e-42	205	421	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.95e-12	202	419	136	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.081025	0.899799	0.018045	0.000365	0.000333	0.000390

TMHMM  Annotations     

start	end
7	24