CAZyme Information: MGYG000004510_02263

Basic Information

• Species: Prevotella sp002481295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002481295
• CAZyme ID: MGYG000004510_02263
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		51657.83	9.6054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004510	3097673	MAG	Israel	Asia

• Gene Location: Start: 9846; End: 11165 Strand: +

Full Sequence      

MIDQILYYISRFVDFLRGLNVDNVVRTYWFLFFVEFPRYYLLEYGVMVYCFFTGGKRRRQ
RAVAKWLLHHDRPLVSILVPGKNEGKNIYKLVTTLREQTYNNFEIIVVDDGSDDDTPLIC
YDLERAKYISKYLRCDVRGGKASAANFGANAATGKYIIHLDADSSLDREAVENILLPFYM
DNRVKAVGGCVLVRNFKDTICSSLQGYEYLKRIQVGRLVTSQLGIYHIISGAFGAFDAET
LKEIGYWDIGPGLDGDITQKVRKAGHRVAFAHDAVCLTNVPTKWYKLYHQRVRWSRSLVR
FRLRKHLDILLPNRNWNFLNFVSNMESIFYDCILNFVWWFYIINLVFTFQTAFLQVFVLG
YLLRIVLNYIGWGLVRVVSERPRDTYWYLRYLPLMPAYSGWFLRMARTVAQLSELFFFQS
YKDNWNPYKTSRSAQLERM

Enzyme Prediction     

No EC number prediction in MGYG000004510_02263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	76	244	3.1e-28	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.32e-47	77	248	1	173	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	3.19e-35	45	365	29	336	N-glycosyltransferase; Provisional
COG1215	BcsA	1.10e-31	31	417	9	381	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.47e-28	76	234	1	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK14583	hmsR	1.26e-26	73	349	75	344	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85412.1	2.85e-214	1	438	1	438
QNT65453.1	1.35e-207	8	437	7	436
APD07883.1	8.57e-142	8	435	4	431
AZJ36032.1	2.03e-141	9	435	10	436
CAG5084162.1	4.32e-138	1	435	1	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.39e-12	74	198	6	123	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	3.85e-10	73	169	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z86_A	2.19e-09	73	181	375	482	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.19e-09	73	181	374	481	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
7SP7_A	8.45e-09	75	300	85	349	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	5.21e-26	71	338	73	332	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	7.10e-26	71	338	73	332	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HKQ0	9.52e-26	48	297	23	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	4.48e-25	48	297	23	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q7A351	3.82e-22	75	297	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998037	0.001836	0.000040	0.000005	0.000004	0.000074

TMHMM  Annotations     

start	end
30	52
327	349
353	375