CAZyme Information: MGYG000004513_01121

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01121
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526		60429.78	9.5371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 19007; End: 20587 Strand: +

Full Sequence      

MKSGWFAATVAALSALTAAAFDSSGTLLLEERCDTPSKLVRRSGEHVTLPDGTAALKVTG
SEKRPFSGVRLRLPLKPEHAEKVLYLRARLKYENVSKPLRPWNGVKFMITTRLNGKFQYH
QRGSEYGSREWFDAEIYAPLDPGAEPQATFSIGLEDSTGTLYVRDIQARVMNLTDLYPAY
APAGYRPQYTRRVLDERRRRGTMSPSTFLPDSTISQDLPELKRWGANLIRWQLIRNWGKT
GTDQDTAEYLEWVKARIPEVRQVLDFAAENDMKVVLDLHVPPGGRRKRGDMNMFHERKFA
DAFLEAWKLLASAVKGHPALYGYDLINEPTAWSKTPIDYLGLQYEAAKVVRAIDPKTPII
VESNLWCKAATYKYMQLIPLPDVIYQLHFYTPTEYTHMGVGGRKNRPEFRYPGKFRTTGG
SEIMLDKNYLREQLRPVREFQLRHGAKIYVGEFSAVRWAAGREQYLADLIDLFEEYGWDW
SYHAFREWSGWSVEHSDNKEETEPTTAPTRAKQVLLEAFKRNQSRP

Enzyme Prediction     

No EC number prediction in MGYG000004513_01121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	215	503	1.3e-39	0.7781818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.16e-23	210	483	22	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.04e-08	202	498	30	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44501.1	1.53e-120	51	523	51	504
AVM46198.1	1.97e-120	44	523	31	501
AVM45720.1	6.40e-117	51	523	100	563
AVM45721.1	1.02e-115	86	522	90	514
AVM43433.1	2.64e-111	83	523	79	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AMC_A	1.48e-15	260	485	76	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
4LX4_A	2.29e-15	225	454	51	254	CrystalStructure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]
1CEC_A	6.29e-15	242	482	56	315	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
3AZR_A	8.74e-15	260	485	76	288	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AMG_A	8.74e-15	260	485	76	288	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S3	1.43e-14	242	482	56	315	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
A3DJ77	2.57e-14	242	482	56	315	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	2.57e-14	242	482	56	315	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000343	0.998998	0.000180	0.000170	0.000157	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01121.