CAZyme Information: MGYG000004536_01903

Basic Information

• Species: Alistipes sp900542505
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900542505
• CAZyme ID: MGYG000004536_01903
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000004536_36|CGC1	31985.56	5.8968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004536	2335647	MAG	Israel	Asia

• Gene Location: Start: 4930; End: 5811 Strand: -

Full Sequence      

MKRSLLFVLLLALLVGNRAAAARIDTLSLRSAALGREVTVVAVLPDAASECRPAPLLLLL
HGYGGDAFSWLKIRTGLPELVDRTGIALLCPDGGQSWYMDSPVDTTSRYESFLVGELIPY
ADAHLPVARDARRRAVAGLSMGGFGAMRLGLLHPDLFGAAGSMSGGLDIRPFPGRWELDR
LLGRQSESPENWERMTPINLIAQLDPARVPALIIDCGYDDFIFEVNCAFHRELRRRGIPH
DFCVRPGGHELSYWANAIDYQMLFFSKFFAAADSAADSAADSESGAESHPSNR

Enzyme Prediction     

No EC number prediction in MGYG000004536_01903.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	31	260	6.3e-49	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.82e-28	17	259	13	302	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.13e-16	31	254	1	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.72e-14	102	258	138	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG1506	DAP2	1.08e-04	138	259	479	604	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG4947	COG4947	3.06e-04	77	254	51	219	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR22371.1	2.23e-25	17	256	37	267
ACX30660.1	1.77e-23	23	262	41	270
APS38647.1	1.52e-22	23	258	42	268
AHM62619.1	3.78e-22	15	258	34	268
ATP57431.1	6.30e-22	23	256	43	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	9.11e-30	34	254	14	250	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
5VOL_A	1.52e-24	55	263	45	265	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
4ROT_A	3.45e-21	31	259	17	251	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	2.82e-18	31	259	14	246	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
6VH9_A	8.97e-18	26	258	7	245	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.70e-18	34	261	13	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P9WM38	6.59e-16	30	249	180	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	6.59e-16	30	249	180	425	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P9WQN7	4.06e-11	19	167	31	172	MPT51/MPB51 antigen OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mpt51 PE=1 SV=1
P9WQN6	4.06e-11	19	167	31	172	MPT51/MPB51 antigen OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mpt51 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999112	0.000159	0.000158	0.000138	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004536_01903.