CAZyme Information: MGYG000004556_01097

Basic Information

• Lineage: Bacteria; Firmicutes_B; Peptococcia; Peptococcales; Peptococcaceae
• CAZyme ID: MGYG000004556_01097
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000004556_126|CGC1	51569.78	4.3644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004556	3007191	MAG	France	Europe

• Gene Location: Start: 2075; End: 3457 Strand: -

Full Sequence      

MKKHVMIIMLTLLMVLGISSTACGAEEEKPFRVVGYYSEAFFDEPVDRLPMDKLTHIMYA
FLIPNADGTVMPIEKPDQLREMVEKAHANDVQVFISIGGWSYGTEALAPRFEAIAATKEN
RAVFIENVLAVVREYDLDGVELDWEYPLMTSGQVYEDLVVEMSAALAKEGKELTAALNGA
WSVEEGPEVSKIVSAKCLDAFAFINVMSYDMNNDNHSPLWFADTSIGYYTIGRGMPESKV
VLGMPLYAHPSWMQYRQLVEANPAYAYQDHVPAGEVSTLESYYNGLNTLREKTALAYRKA
GGVMLFDVNEDSTDEYSVLSMIDEVRKEAEAMGREAFERKVLVFVNDRPLTFKAEEKMGD
AFIDANDRTLLPLRKPLEALQAEVVYHEQERTVEISKDDTVVCVTIDSPVITINGEPKEM
DTQAVIKDGRTYIPARAVFEAFGCTVDWHAVSQAIYITQK

Enzyme Prediction     

No EC number prediction in MGYG000004556_01097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	32	318	1.7e-48	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	2.20e-55	33	322	1	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	1.04e-49	32	311	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.25e-45	32	252	1	240	Glyco_18 domain.
cd06548	GH18_chitinase	2.19e-39	33	304	1	315	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	2.12e-37	55	249	29	245	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX64831.1	9.38e-170	17	457	33	469
ARE87297.1	1.34e-157	8	457	13	458
AOY76825.1	1.34e-157	8	457	13	458
QZY56942.1	6.80e-150	9	460	11	459
QAT42625.1	7.37e-144	7	460	9	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	7.10e-35	27	322	13	301	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6LE8_A	1.05e-20	55	247	32	251	ChainA, Probable endochitinase [Caenorhabditis elegans]
6LE7_A	1.06e-20	55	247	31	250	ChainA, Probable endochitinase [Caenorhabditis elegans]
6LDU_A	1.08e-20	55	247	32	251	ChainA, Probable endochitinase [Caenorhabditis elegans]
3W4R_A	7.09e-19	8	247	4	272	Crystalstructure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q11174	1.86e-19	55	247	83	302	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
P36362	5.18e-18	16	247	8	270	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q91XA9	3.00e-17	55	249	52	269	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
Q9BZP6	3.04e-17	55	249	52	269	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
Q92222	8.84e-16	31	247	4	257	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000336	0.099631	0.899814	0.000069	0.000080	0.000067

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004556_01097.