CAZyme Information: MGYG000004566_00372

Basic Information

• Species: Pauljensenia cardiffensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia cardiffensis
• CAZyme ID: MGYG000004566_00372
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		53090.44	5.1634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004566	1432751	MAG	France	Europe

• Gene Location: Start: 1759; End: 3237 Strand: -

Full Sequence      

MHSSSVLCSLGIALSLVLVPLGPQEAFGAPSAQTATPSSLPEPSSIKTVVSSSILDYSGS
GTWVKSASHWKWRLTSGDYLKNSWARISGVDYYFDAAGIMASGWRYLNGWYHFASSGAKE
SGWIRSAGYWYFLDPLEGIMQTGFISTGGARYFLESNGAMSLGWVVSEGNWYYADPLQGG
SLATSVRTLSDGTYTFESSGKMATGWTLVSGKWQYFASSGRRVLGWVLDQGNWFYLDPSS
ANMAIGWLALGGSWYWLDPSSGAMTTGWLRDGDAWYWLDPSSGAMATGTAITNGRLSRFD
SSGRWISYIDQHPIIAQPSASQSSLIASMTQVYLNTGRPYPTWALSSGGAGDITAFVTIL
YEEAAAEGISPELVFCQVMKETGWLQFGGDVTASQFNFAGLGAVGGGAAGASFPSVRIGV
RAQVQHLRAYADPWASSATLAYPLVDPRFTYVRKGSAPYIEYLGIQENPNGVGWATAKNY
GYDLVSMMDAYF

Enzyme Prediction     

No EC number prediction in MGYG000004566_00372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	359	491	3.3e-18	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	8.90e-51	81	285	442	621	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.52e-45	81	306	485	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	7.68e-43	118	294	440	590	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	4.58e-38	63	272	445	650	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
COG5263	COG5263	1.79e-34	61	306	60	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD80262.1	4.92e-84	293	492	190	389
BAW93920.1	6.19e-82	289	492	187	390
ARD41193.1	1.85e-80	289	492	186	389
QCT35925.1	2.38e-74	289	492	462	686
QGS10651.1	5.99e-74	294	492	467	682

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	4.84e-14	362	460	77	171	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999085	0.000148	0.000175	0.000138	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004566_00372.