CAZyme Information: MGYG000004588_01018

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_01018
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000004588_15|CGC1	112967.41	7.1645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 22167; End: 25115 Strand: +

Full Sequence      

MHIRHKYLIAALMLLASMGLSAASFTRSGNFITVEVAHPGPNDPQWVRLQVIGKKIIRVE
ATREKAFPEKQSLIIVKQPQPAFSYSVTEDSRDVKINTSAVVAKVDKQTGLVRFYDENGK
QILAEDTGGKQLFPYTVPEREIGVDSHLTDAQKHGWTWLLRFADNKGEALYGLGQHQANE
LNMKGLNEELYQYNTKVSVPFVVSNKGYGILWDSYSYCRFGNPGENLPLNRAFRLYDKNG
VAGNLTGTYTDRDGKTITRAEDSICYEVSLPALALKRNSDGDVSHLPAGFKLNGAHVTYE
GYLEAPVDNNYHFNLYYAGYTKVYVDGKEVVPEHWRQAWNPNACRFNVPMRAGQKVKLLI
DWLPDGDVSYCALRVAPPRSEQRQQQLTVWSEMAKDLDYYFIAGNTVDEVIHGYRTLTGK
AQVLPKWALGFWQSRERYRTSDDIEKTLAEFRRRHIPVDNIVQDWNYWADDQWGSHQFEA
SRYPNPQAMFDSVHQMHGRFMISVWPKFYPNTKNYQELDAKGWMYHQSIADSIRDWVGPG
YMNSFYDAYAEGARKMFWRQMDENLYTKYHHGIDAWWMDASEPNVRDCTPMWYRKALSGP
TAMGSTTEYFNAYSLVNADAIYNGQREVNPNQRVFLLTRSGFAGEQRFSTATWSGDIGTR
WEDMRAQMTAGLNYNMAGLPFWGMDQGGFSVENRYVKAQQLYDKTGEENADLKEWRELQT
RWNEFGCFIPLYRTHGQWPLREVWNIAPESHPAYKAIVWYDRLRYRLMPYIYSLAGAVHF
SDYTMMRALVMDFNGDDKVYNVKDQWMFGPSLMACPVAKYQARSREVYLPAQRGWYDLLS
GKHYDGGQTITADAPLERIPVFVPEGSLLPLGPEMEWSDEKPAETIDLYVFAGRDGSFTL
YEDENTNYNYEKGRYATIPMTWNEHQHTLTIGARKGTFNGMLKNRKFNVILVSPTHAQGL
DIDHAVKGKLVKYNGSRVVVKL

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	399	868	1.4e-137	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	3.32e-164	400	869	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.04e-149	390	948	227	750	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	2.42e-147	419	764	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
cd06603	GH31_GANC_GANAB_alpha	4.43e-60	419	871	1	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06598	GH31_transferase_CtsZ	2.52e-59	419	775	1	330	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS86029.1	0.0	6	982	5	981
QNT65144.1	0.0	1	982	1	983
VEH16024.1	0.0	6	982	5	980
ADE81187.1	0.0	4	982	3	1007
QVJ80354.1	0.0	4	982	3	1030

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JOU_A	0.0	25	982	27	955	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	8.52e-271	47	952	79	948	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	2.76e-266	47	981	68	985	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	2.61e-67	394	972	233	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	3.06e-66	394	972	233	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	0.0	14	982	12	954	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	1.46e-138	383	979	176	726	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9F234	1.76e-62	397	915	230	721	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
A2QTU5	2.42e-50	397	862	234	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
Q01336	3.01e-47	45	736	18	523	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.050290	0.941236	0.007623	0.000309	0.000253	0.000259

TMHMM  Annotations     

start	end
7	26