CAZyme Information: MGYG000004611_00100

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus
• CAZyme ID: MGYG000004611_00100
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000004611_2|CGC1	41441.45	9.369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004611	1855749	MAG	France	Europe

• Gene Location: Start: 27858; End: 28997 Strand: -

Full Sequence      

MTRIFISAGELSGDLHAAALTRAILEQDPTAQVFGMGGEVFRKAGGEVVFNYKEYSVMGF
GEALQALPKLFALKKAFTEEIHKRKPDLFVTIDYPEFNMRVAKTVHQMGIPVFCFIPPSA
WAWRRGRAKDVASFADKVACIYPFAAKVYQEAGAPAEFVGNPLVDIVHPNLPRGEAEKFA
GKRAGHPLILLLPGSRRKEITGVLPKMLQALPLIQKKCPEADFVLEKAASIDAELLQSIL
TRSSVPVKVVEGNNYDVMSVSDVALATSGTVTLEAALCGLPTVLCYHASAFSIWLARRLV
YVKYAGLPNILAGKEIFPELIQEKMTPDNIAKYALRFLEPDANRKIKQEMAEAVAKLGKP
GAVNRTASLILATAKKENQ

Enzyme Prediction     

No EC number prediction in MGYG000004611_00100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2e-118	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.92e-130	1	377	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.62e-114	1	376	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.13e-92	4	372	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	1.35e-52	1	332	1	311	lipid-A-disaccharide synthase.
PRK01021	lpxB	3.11e-41	5	357	230	585	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48042.1	1.00e-193	1	375	1	375
AEQ21864.1	1.89e-172	3	377	2	376
QTV78315.1	2.73e-137	1	371	6	376
BBG63223.1	4.63e-137	1	377	1	377
QNP77898.1	4.63e-137	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.01e-54	4	357	9	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.93e-53	4	357	9	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	6.14e-84	4	378	6	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	7.09e-83	3	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	7.95e-82	3	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	3.07e-81	3	371	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	3.84e-79	3	371	8	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004611_00100.