CAZyme Information: MGYG000004611_00157

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus
• CAZyme ID: MGYG000004611_00157
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39694	8.9129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004611	1855749	MAG	France	Europe

• Gene Location: Start: 13676; End: 14728 Strand: -

Full Sequence      

MDYKNILMIKMSSLGDVIHALPFAAALRDRYPKSRISWLVHPQFSAFVPDPPLIDEVLYF
DKAAFNKMNWRDKWCTYRTLRQTLRSRHFDLVIDLQGLFKSAVMALLTGCSQRIGYCEMR
EGSGLVSRPIVGPHRNDHVIERYLDVARYLGAKVDTIRYPMPPMHKEQESVHKNLIAAGM
PEGERQPYVVFVPGARWDTKRWPVEYFARLAMLVIQDGYYVVLAGGTGDKPLGEKIRKAV
KDHPHLVDFIGKTSLRELGALIKDCQFYVSGDTGPLHIATALQKRTVSIYGPTRPDRTGP
YGNPNSVVLMSPVDCAGCLKKQCEHWNCMHAVSPEEVYAILREKGGEPYD

Enzyme Prediction     

No EC number prediction in MGYG000004611_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	325	5.9e-68	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.80e-85	4	337	2	322	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	6.96e-76	5	343	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.05e-58	78	323	2	241	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02193	heptsyl_trn_I	5.87e-55	5	343	1	317	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02195	heptsyl_trn_II	2.09e-41	5	343	1	331	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48008.1	8.26e-188	1	344	1	344
QTV78223.1	3.46e-156	1	347	3	348
AEQ22075.1	2.20e-155	17	350	1	332
QNP77240.1	7.41e-152	1	344	1	340
BBG62450.1	1.22e-150	1	344	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	6.28e-27	5	312	2	300	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	6.28e-27	5	312	2	300	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	7.18e-27	5	312	2	300	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	6.88e-23	5	310	2	307	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	2.83e-18	1	309	6	305	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	5.83e-26	5	312	2	300	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
Q57336	4.60e-25	4	308	9	299	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37421	8.87e-25	5	310	2	307	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P26469	2.73e-24	5	312	2	300	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P45042	8.09e-24	5	310	2	307	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004611_00157.