CAZyme Information: MGYG000004611_01715

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus
• CAZyme ID: MGYG000004611_01715
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		63015.75	9.909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004611	1855749	MAG	France	Europe

• Gene Location: Start: 3102; End: 4745 Strand: +

Full Sequence      

MRKRYWLFFWLTAIFLLFVFNGSLPITDSVEGNYSLSAKEMLLTGDWISPQIYGKYWFDK
PVFSYWMIALGFKLFGFSEFGARFFPSLFGLLGLWLTVWTGKKLYSSEVGLFSGVLLLMT
MEFFTISKSVLTDGMLFFFMNGVLVCYYLAYSGKNKRYYYGSYALAGLATLTKGPIGFLL
PGLIIVLFLCWRRDWRSLRQAKLGSGLLLFLLIVAPWYVTMAQLHPDFLQSFLGTQNVFR
ATVAEHPQYNVPWYYIAVNLLNAYAWIGLLPGMVYHLFHKADRWELPSQREGFLFLWASV
IFLFFTCMVTKYITYTYPLLLPLCVLMAAYIWKRGRNLPVKGMLTGNLLFYGALTVFVFN
MKKWAPTLKLPGSDMLLYFFLIYFLCMVVLAFHQYKGKSSMEIFTTIMLLTVAFHICSLE
LLAKPLMADVSGKAAAQVINRTLPQNVPIYVQGGGYPTSTVFYTGRTLTFLVPDDRVEEF
KPRDGSWAVKNIMPWTTYGDLYKTNGQAMVLVDTHTKQKLPDLTKTWPGTWKKIKLQGQW
SILVRER

Enzyme Prediction     

No EC number prediction in MGYG000004611_01715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	476	1.2e-101	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.41e-46	1	391	6	398	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.37e-41	1	367	1	372	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.40e-21	59	195	1	137	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.71e-12	34	228	35	241	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	4.15e-05	1	169	14	201	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB46704.1	1.43e-280	1	547	1	546
AEQ23377.1	5.75e-249	1	547	1	545
QTV78033.1	1.29e-128	1	497	1	485
AVO27725.1	1.29e-108	16	542	38	505
ADB46573.1	2.91e-107	4	546	17	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.04e-29	31	320	59	353	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	8.31e-35	31	367	32	371	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A0KGY4	1.46e-34	10	374	6	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	1.95e-32	25	374	24	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q2NWA9	8.12e-31	10	330	8	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1
Q4KC80	1.38e-30	31	363	32	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.982039	0.017233	0.000568	0.000043	0.000033	0.000094

TMHMM  Annotations     

start	end
5	27
61	78
80	99
109	131
136	153
168	190
203	225
257	279
292	309
313	332
344	361
376	393
400	422