CAZyme Information: MGYG000004636_01639

Basic Information

• Species: Paramuribaculum sp009775605
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp009775605
• CAZyme ID: MGYG000004636_01639
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25976.2	8.3677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004636	2253564	MAG	Germany	Europe

• Gene Location: Start: 3021; End: 3704 Strand: +

Full Sequence      

MCKRISTIFLIYIPAGFVVSSILLVSLLKWIPVTFTPLMIIREFQNIGNNTGSIKYEWIP
LEEISEDVIRVVIVAEDQKFLWHNGFDFEEFTRMKQSHKSDNTLLRGCSTISQQTAKNCF
TFCTHTWLRKAIEAYYTVLIEKIWGKKRIMEVYLNVAEMGPGIYGIEAAAKCYYHRHAAD
LTLADASSLACCLPNPLQRNPDWANRYLSKKRSDIATAAANTTLPPW

Enzyme Prediction     

No EC number prediction in MGYG000004636_01639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	53	214	1.7e-45	0.903954802259887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.17e-78	9	227	11	231	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	5.05e-64	9	225	10	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	9.95e-53	52	224	9	173	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	2.58e-50	8	215	23	235	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.15e-29	3	204	6	219	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53411.1	1.16e-59	4	227	11	233
AVR44737.1	1.15e-58	1	215	1	210
BAR49817.1	2.24e-58	21	215	22	212
AEW20603.1	2.24e-58	21	215	22	212
BAR52639.1	2.24e-58	21	215	22	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.27e-25	52	213	16	177	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.50e-25	52	213	16	177	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.48e-18	37	201	20	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	2.32e-17	59	215	43	199	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	6.34e-16	59	201	40	184	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3V7R3	9.88e-54	17	220	19	222	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
Q11VI0	7.52e-52	17	227	27	239	Biosynthetic peptidoglycan transglycosylase OS=Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) OX=269798 GN=mtgA PE=3 SV=1
B8GYX9	4.97e-49	18	218	21	215	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=mtgA PE=3 SV=1
Q9ABA6	4.97e-49	18	218	21	215	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=mtgA PE=3 SV=1
Q9CNV0	1.15e-48	15	215	29	230	Biosynthetic peptidoglycan transglycosylase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995633	0.004170	0.000048	0.000026	0.000014	0.000133

TMHMM  Annotations     

start	end
9	31